The UBCc domain within your query sequence starts at position 77 and ends at position 222, and its E-value is 3.97e-31.

Some of the required catalytic sites were not detected in this domain, and are marked red in the sequence below. The domain is probably inactive. Check the literature (PubMed 97407928 ) for details.

Catalytic residues
Position
DomainProteinAmino acidPresent?
83159CNo
YSLLAEFTLVVKQKLPGVYVQPSYRSALVWFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCPRLLFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTTSPLNPEAAVLYEKDIQLFKSKVVDSVKVCTA
UBCc

UBCc

Ubiquitin-conjugating enzyme E2, catalytic domain homologues
SMART ACC:SM000212
Description:Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. This pathway functions in regulating many fundamental processes required for cell viability.TSG101 is one of several UBC homologues that lacks this active site cysteine.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 43 578 UBCc domains in 43 296 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing UBCc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing UBCc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Protein-binding, ubiquitin-conjugating

Relevant references for this domain

Primary literature for the UBCc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a UBCc domain which could be assigned to a KEGG orthologous group, and not all proteins containing UBCc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamUQ_con