The DoH domain within your query sequence starts at position 59 and ends at position 148, and its E-value is 7.89e-15.

YVGFGFSPTGSMAAADIVVGGVAHGRPYLQDYFTNADRELEKDAQQDYHLDYAMENSTHTVIEFSRELHTCDVNDKSLTDSTVRVIWAYH
DoH

DoH

Possible catecholamine-binding domain present in a variety of eukaryotic proteins.
SMART ACC:SM000664
Description:A predominantly beta-sheet domain present as a regulatory N-terminal domain in dopamine beta-hydroxylase, mono-oxygenase X and SDR2. Its function remains unknown at present (Ponting, Human Molecular Genetics, in press).
InterPro ACC:IPR005018
InterPro abstract:

The DOMON domain is an 110-125 residue long domain which has been identified in the physiologically important enzyme dopamine beta-monooxygenase and in several other secreted and transmembrane proteins from both plants and animals. It has been named after DOpamine beta-MOnooxygenase N-terminal domain. The DOMON domain can be found in one to four copies and in association with other domains, such … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 897 DoH domains in 5 840 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DoH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DoH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Unknown

Relevant references for this domain

Primary literature for the DoH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DoH domain which could be assigned to a KEGG orthologous group, and not all proteins containing DoH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005018