The ZnF_TTF domain within your query sequence starts at position 528 and ends at position 604, and its E-value is 4.14e-2.

YYTRILPNGEKGTRPWLLYSASKDSVFCLYCRLFGEGKNQLRNENGCKDWHHLSHLLSKHDESEMHINNSVKYSKLK
ZnF_TTF

ZnF_TTF

SMART ACC:SM000597
Description:zinc finger in transposases and transcription factors
InterPro ACC:IPR006580
InterPro abstract:

The TTF zinc finger domain is found in transposases and transcription factors. It is present in eukaryotic proteins but has not been identified in any from fungi and nematodes.

Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 553 ZnF_TTF domains in 4 421 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_TTF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_TTF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZnF_TTF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_TTF domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_TTF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR006580