The domain within your query sequence starts at position 47 and ends at position 226; the E-value for the 35EXOc domain shown below is 1.1e-47.

All catalytic sites are present in this domain. Check the literature (PubMed 99105820 ) for details.

IVYSYEASDCSFLSEDISMRLSDGDVVGFDMEWPPIYKPGKRSRVAVIQLCVSESKCYLF
HISSMSVFPQGLKMLLENKSIKKAGVGIEGDQWKLLRDFDVKLESFVELTDVANEKLKCA
ETWSLNGLVKHVLGKQLLKDKSIRCSNWSNFPLTEDQKLYAATDAYAGLIIYQKLGNLGD

35EXOc

3'-5' exonuclease
35EXOc
SMART accession number:SM00474
Description: 3\' -5' exonuclease proofreading domain present in DNA polymerase I, Werner syndrome helicase, RNase D and other enzymes
Interpro abstract (IPR002562):

This domain is responsible for the 3'-5' exonuclease proofreading activity of Escherichia coli DNA polymerase I (polI) and other enzymes, it catalyses the hydrolysis of unpaired or mismatched nucleotides. This domain consists of the amino-terminal half of the Klenow fragment in E. coli polI it is also found in the Werner syndrome helicase (WRN), focus forming activity 1 protein (FFA-1) and ribonuclease D (RNase D) [ (PUBMED:9697700) ].

Werner syndrome is a human genetic disorder causing premature aging; the WRN protein has helicase activity in the 3'-5' direction [ (PUBMED:9288107) (PUBMED:9224595) ]. The FFA-1 protein is required for formation of a replication foci and also has helicase activity; it is a homologue of the WRN protein [ (PUBMED:9697700) ]. RNase D is a 3'-5' exonuclease involved in tRNA processing. Also found in this family is the autoantigen PM/Scl thought to be involved in polymyositis-scleroderma overlap syndrome.

GO process:nucleobase-containing compound metabolic process (GO:0006139)
GO function:nucleic acid binding (GO:0003676), 3'-5' exonuclease activity (GO:0008408)
Family alignment:
View or

There are 40504 35EXOc domains in 40484 proteins in SMART's nrdb database.

Click on the following links for more information.