The domain within your query sequence starts at position 180 and ends at position 470; the E-value for the 6PGD domain shown below is 7.75e-219.
GHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMRHEEMAQAFEEWNKTELDSFLIEITANI LKYRDTDGKELLPKIRDSAGQKGTGKWTAISALEYGMPVTLIGEAVFARCLSSLKEERVQ ASQKLKGPKVVQLEGSKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIA LMWRGGCIIRSVFLGKIKDAFERNPELQNLLLDDFFKSAVDNCQDSWRRVISTGVQAGIP MPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLTKPGEFIHTNWT
6PGD6-phosphogluconate dehydrogenase, C-terminal domain |
---|
SMART accession number: | SM01350 |
---|---|
Description: | This family represents the C-terminal all-alpha domain of 6-phosphogluconate dehydrogenase. The domain contains two structural repeats of 5 helices each. |
Interpro abstract (IPR006114): | 6-Phosphogluconate dehydrogenase ( EC 1.1.1.44 ) (6PGD) is an oxidative carboxylase that catalyses the decarboxylating reduction of 6-phosphogluconate into ribulose 5-phosphate in the presence of NADP. This reaction is a component of the hexose mono-phosphate shunt and pentose phosphate pathways (PPP) [ (PUBMED:2113917) (PUBMED:6641716) ]. Prokaryotic and eukaryotic 6PGD are proteins of about 470 amino acids whose sequences are highly conserved [ (PUBMED:1659648) ]. The protein is a homodimer in which the monomers act independently [ (PUBMED:6641716) ]: each contains a large, mainly alpha-helical domain and a smaller beta-alpha-beta domain, containing a mixed parallel and anti-parallel 6-stranded beta sheet [ (PUBMED:6641716) ]. NADP is bound in a cleft in the small domain, the substrate binding in an adjacent pocket [ (PUBMED:6641716) ]. This entry represents the C-terminal all-alpha domain of 6-phosphogluconate dehydrogenase. The domain contains two structural repeats of 5 helices each. The NAD-binding domain is described in IPR006115 . |
GO process: | pentose-phosphate shunt (GO:0006098), oxidation-reduction process (GO:0055114) |
GO function: | phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616) |
Family alignment: |
There are 19935 6PGD domains in 19931 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)