The domain within your query sequence starts at position 670 and ends at position 845; the E-value for the AAA domain shown below is 4.07e-8.

EGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFG
HPLQENYYKAVMEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNSDIY
LFDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVMSGGK

AAA

ATPases associated with a variety of cellular activities

• SMART accession number: SM00382
• Description: AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
• Interpro abstract (IPR003593):

  The AAA+ superfamily of ATPases is found in all kingdoms of living organisms where they participate in diverse cellular processes including membrane fusion, proteolysis and DNA replication. Although the terms AAA+ and AAA are often used loosely and interchangeably, the classical AAA family members are distinguished by their possession of the SRH region in the AAA module. Many AAA+ proteins are involved in similar processes to those of AAA proteins (facilitation of protein folding and unfolding, assembly or disassembly of proteins complexes, protein transport and degradation), but others function in replication, recombination, repair and transcription. For a review see [(PUBMED:11473577)].

  The proteins in this superfamily are characterised by the structural conservation of a central ATPase domain of about 250 amino acids called the AAA+ module. Typically, the AAA+ domain can be divided into two structural subdomains, an N-terminal P-loop NTPase alpha-beta-alpha subdomain that is connected to a smaller C-terminal all-alpha subdomain. The alpha-beta-alpha subdomain adopts a Rossman fold and contains several motifs involved in ATP binding and hydrolysis, including classical motifs Walker A and Walker B [(PUBMED:11473577), (PUBMED:18466635)]. The all-alpha subdomain [(PUBMED:9927482)], is much less conserved across AAA+ proteins.

• GO function: nucleoside-triphosphatase activity (GO:0017111), nucleotide binding (GO:0000166)

There are 225485 AAA domains in 195183 proteins in SMART's nrdb database.

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Neuwald AF, Aravind L, Spouge JL, Koonin EV
• AAA+: A class of chaperone-like ATPases associated with the assembly, operation, and disassembly of protein complexes.
• Genome Res. 1999; 9: 27-43

Using a combination of computer methods for iterative database searches and multiple sequence alignment, we show that protein sequences related to the AAA family of ATPases are far more prevalent than reported previously. Among these are regulatory components of Lon and Clp proteases, proteins involved in DNA replication, recombination, and restriction (including subunits of the origin recognition complex, replication factor C proteins, MCM DNA-licensing factors and the bacterial DnaA, RuvB, and McrB proteins), prokaryotic NtrC-related transcription regulators, the Bacillus sporulation protein SpoVJ, Mg2+, and Co2+ chelatases, the Halobacterium GvpN gas vesicle synthesis protein, dynein motor proteins, TorsinA, and Rubisco activase. Alignment of these sequences, in light of the structures of the clamp loader delta' subunit of Escherichia coli DNA polymerase III and the hexamerization component of N-ethylmaleimide-sensitive fusion protein, provides structural and mechanistic insights into these proteins, collectively designated the AAA+ class. Whole-genome analysis indicates that this class is ancient and has undergone considerable functional divergence prior to the emergence of the major divisions of life. These proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes. The hexameric architecture often associated with this class can provide a hole through which DNA or RNA can be thread; this may be important for assembly or remodeling of DNA-protein complexes.

• Lenzen CU, Steinmann D, Whiteheart SW, Weis WI
• Crystal structure of the hexamerization domain of N-ethylmaleimide-sensitive fusion protein.
• Cell. 1998; 94: 525-36

N-ethylmaleimide-sensitive fusion protein (NSF) is a cytosolic ATPase required for many intracellular vesicle fusion reactions. NSF consists of an amino-terminal region that interacts with other components of the vesicle trafficking machinery, followed by two homologous ATP-binding cassettes, designated D1 and D2, that possess essential ATPase and hexamerization activities, respectively. The crystal structure of D2 bound to Mg2+-AMPPNP has been determined at 1.75 A resolution. The structure consists of a nucleotide-binding and a helical domain, and it is unexpectedly similar to the first two domains of the clamp-loading subunit delta' of E. coli DNA polymerase III. The structure suggests several regions responsible for coupling of ATP hydrolysis to structural changes in full-length NSF.

• Patel S, Latterich M
• The AAA team: related ATPases with diverse functions.
• Trends Cell Biol. 1998; 8: 65-71

A new family of related ATPases has emerged, characterized by a highly conserved AAA motif. This motif forms a 230-amino-acid domain that contains Walker homology sequences and imparts ATPase activity. Homology between AAA-family members is confined mostly to the AAA domain, although additional homology outside the AAA motif is present among closely related proteins. AAA proteins act in a variety of cellular functions, including cell-cycle regulation, protein degradation, organelle biogenesis and vesicle-mediated protein transport. The AAA domain is required for protein function, but its exact role and the specific activity that it confers on AAA proteins is still unclear. This review describes current understanding of the AAA protein family.

Disease (disease genes where sequence variants are found in this domain)

SwissProt sequences and OMIM curated human diseases associated with missense mutations within the AAA domain.

Protein	Disease
Peroxisome biogenesis factor 1 (O43933) (SMART)	OMIM:602136: Zellweger syndrome-1 OMIM:214100: Adrenoleukodystrophy, neonatal OMIM:202370: Refsum disease, infantile OMIM:266510:
DNA repair protein RAD51 homolog 1 (Q06609) (SMART)	OMIM:179617: {Breast cancer, susceptibility to} OMIM:114480:
Canalicular multispecific organic anion transporter 1 (Q92887) (SMART)	OMIM:601107: Dubin-Johnson syndrome OMIM:237500:
Retinal-specific ATP-binding cassette transporter (P78363) (SMART)	OMIM:601691: Stargardt disease-1 OMIM:248200: Retinitis pigmentosa-19 OMIM:601718: Cone-rod dystrophy 3 ; Macular dystrophy, age-related, 2 OMIM:153800: Fundus flavimaculatus OMIM:248200:
Cystic fibrosis transmembrane conductance regulator (P13569) (SMART)	OMIM:602421: Cystic fibrosis OMIM:219700: Congenital bilateral absence of vas deferens OMIM:277180: Sweat chloride elevation without CF ; {Pancreatitis, idiopathic} ; {Hypertrypsinemia, neonatal}
Antigen peptide transporter 2 (Q03519) (SMART)	OMIM:170261: Bare lymphocyte syndrome, type I, due to TAP2 deficiency
Peroxisome assembly factor 2 (Q13608) (SMART)	OMIM:601498: Peroxisomal biogenesis disorder, complementation group 4
ATP-binding cassette sub-family D member 1 (P33897) (SMART)	OMIM:300100: Adrenoleukodystrophy ; Adrenomyeloneuropathy
ATP-binding cassette sub-family A member 1 (O95477) (SMART)	OMIM:600046: Tangier disease OMIM:205400: HDL deficiency, familial OMIM:604091:
Spastin (Q9UBP0) (SMART)	OMIM:182601: Spastic paraplegia-4 OMIM:604277: Spastic paraplegia-4 OMIM:182601:
ATP-binding cassette sub-family C member 8 (Q09428) (SMART)	OMIM:600509: Persistent hyperinsulinemic hypoglycemia of infancy OMIM:256450:
Antigen peptide transporter 1 (Q03518) (SMART)	OMIM:170260: TRANSPORTER, ATP-BINDING CASSETTE, MAJOR HISTOCOMPATIBILITY COMPLEX

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
72.32	map02010	ABC transporters - General
4.51	map03060	Protein export
3.93	map03030	DNA replication
3.06	map03090	Type II secretion system
2.69	map00190	Oxidative phosphorylation
1.92	map00195	Photosynthesis
1.85	map02020	Two-component system - General
1.57	map02040	Flagellar assembly
1.26	map03070	Type III secretion system
1.06	map00910	Nitrogen metabolism
0.87	map03050	Proteasome
0.79	map00790	Folate biosynthesis
0.75	map00860	Porphyrin and chlorophyll metabolism
0.67	map00500	Starch and sucrose metabolism
0.57	map04111	Cell cycle - yeast
0.56	map04110	Cell cycle
0.37	map00230	Purine metabolism
0.27	map03080	Type IV secretion system
0.15	map00240	Pyrimidine metabolism
0.14	map05212	Pancreatic cancer
0.11	map04310	Wnt signaling pathway
0.07	map04612	Antigen processing and presentation
0.06	map00400	Phenylalanine, tyrosine and tryptophan biosynthesis
0.06	map00920	Sulfur metabolism
0.06	map00450	Selenoamino acid metabolism
0.05	map00730	Thiamine metabolism
0.05	map04930	Type II diabetes mellitus
0.03	map00780	Biotin metabolism
0.03	map00310	Lysine degradation
0.02	map05120	Epithelial cell signaling in Helicobacter pylori infection
0.02	map00440	Aminophosphonate metabolism
0.02	map00540	Lipopolysaccharide biosynthesis
0.01	map00010	Glycolysis / Gluconeogenesis
0.01	map00271	Methionine metabolism
0.01	map00770	Pantothenate and CoA biosynthesis
0.01	map00260	Glycine, serine and threonine metabolism
0.01	map00350	Tyrosine metabolism
0.01	map00251	Glutamate metabolism
0.01	map00650	Butanoate metabolism
0.01	map00120	Bile acid biosynthesis
0.01	map00710	Carbon fixation
0.01	map00460	Cyanoamino acid metabolism
0.01	map00632	Benzoate degradation via CoA ligation
0.01	map00564	Glycerophospholipid metabolism
0.01	map00300	Lysine biosynthesis
0.01	map00903	Limonene and pinene degradation
0.01	map00624	1- and 2-Methylnaphthalene degradation
0.01	map00630	Glyoxylate and dicarboxylate metabolism
0.01	map00480	Glutathione metabolism
0.01	map00550	Peptidoglycan biosynthesis
0.01	map00362	Benzoate degradation via hydroxylation
0.01	map00272	Cysteine metabolism
0.01	map00030	Pentose phosphate pathway

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with AAA domain which could be assigned to a KEGG orthologous group, and not all proteins containing AAA domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of AAA domains in PDB

PDB code	Title
1b0u	Atp-binding subunit of the histidine permease from salmonella typhimurium
1bmf	Bovine mitochondrial f1-atpase
1cow	Bovine mitochondrial f1-atpase complexed with aurovertin b
1d2n	D2 domain of n-ethylmaleimide-sensitive fusion protein
1do0	Orthorhombic crystal form of heat shock locus u (hslu) from escherichia coli
1do2	Trigonal crystal form of heat shock locus u (hslu) from escherichia coli
1e1q	Bovine mitochondrial f1-atpase at 100k
1e1r	Bovine mitochondrial f1-atpase inhibited by mg2+adp and aluminium fluoride
1e32	Structure of the n-terminal domain and the d1 aaa domain of membrane fusion atpase p97
1e69	Smc head domain from thermotoga maritima
1e79	Bovine f1-atpase inhibited by dccd (dicyclohexylcarbodiimide)
1e94	Hslv-hslu from e.coli
1efr	Bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin
1f3o	Crystal structure of mj0796 atp-binding cassette
1f48	Crystal structure of the escherichia coli arsenite- translocating atpase
1ffh	N and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
1fnn	Crystal structure of cdc6p from pyrobaculum aerophilum
1fts	Signal recognition particle receptor from e. coli
1fx0	Crystal structure of the chloroplast f1-atpase from spinach
1g18	Reca-adp-alf4 complex
1g19	Structure of reca protein
1g29	Malk
1g3i	Crystal structure of the hsluv protease-chaperone complex
1g41	Crystal structure of hslu haemophilus influenzae
1g4a	Crystal structures of the hslvu peptidase-atpase complex reveal an atp-dependent proteolysis mechanism
1g4b	Crystal structures of the hslvu peptidase-atpase complex reveal an atp-dependent proteolysis mechanism
1g6h	Crystal structure of the adp conformation of mj1267, an atp- binding cassette of an abc transporter
1g8p	Crystal structure of bchi subunit of magnesium chelatase
1g8y	Crystal structure of the hexameric replicative helicase repa of plasmid rsf1010
1g9x	Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter
1gaj	Crystal structure of a nucleotide-free atp-binding cassette from an abc transporter
1h8e	(adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)
1h8h	Bovine mitochondrial f1-atpase crystallised in the presence of 5mm amppnp
1hqc	Structure of ruvb from thermus thermophilus hb8
1hqy	Nucleotide-dependent conformational changes in a protease- associated atpase hslu
1ht1	Nucleotide-dependent conformational changes in a protease- associated atpase hslu
1ht2	Nucleotide-dependent conformational changes in a protease- associated atpase hslu
1ihu	Crystal structure of the escherichia coli arsenite- translocating atpase in complex with mg-adp-alf3
1ii0	Crystal structure of the escherichia coli arsenite- translocating atpase
1ii9	Crystal structure of the escherichia coli arsenite- translocating atpase in complex with amp-pnp
1im2	Hslu, haemophilus influenzae, selenomethionine variant
1in4	Thermotoga maritima ruvb holliday junction branch migration motor
1in5	Thermogota maritima ruvb a156s mutant
1in6	Thermotoga maritima ruvb k64r mutant
1in7	Thermotoga maritima ruvb r170a
1in8	Thermotoga maritima ruvb t158v
1iqp	Crystal structure of the clamp loader small subunit from pyrococcus furiosus
1ixr	Ruva-ruvb complex
1ixs	Structure of ruvb complexed with ruva domain iii
1ixz	Crystal structure of the ftsh atpase domain from thermus thermophilus
1iy0	Crystal structure of the ftsh atpase domain with amp-pnp from thermus thermophilus
1iy1	Crystal structure of the ftsh atpase domain with adp from thermus thermophilus
1iy2	Crystal structure of the ftsh atpase domain from thermus thermophilus
1j7k	Thermotoga maritima ruvb p216g mutant
1j8m	Signal recognition particle conserved gtpase domain from a. ambivalens
1j8y	Signal recognition particle conserved gtpase domain from a. ambivalens t112a mutant
1jbk	Crystal structure of the first nucelotide binding domain of clpb
1ji0	Crystal structure analysis of the abc transporter from thermotoga maritima
1jj7	Crystal structure of the c-terminal atpase domain of human tap1
1jpj	Gmppnp complex of srp gtpase ng domain
1jpn	Gmppnp complex of srp gtpase ng domain
1jr3	Crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii
1kmh	Crystal structure of spinach chloroplast f1-atpase complexed with tentoxin
1ksf	Crystal structure of clpa, an hsp100 chaperone and regulator of clpap protease: structural basis of differences in function of the two aaa+ atpase domains
1kyi	Hsluv (h. influenzae)-nlvs vinyl sulfone inhibitor complex
1l2t	Dimeric structure of mj0796, a bacterial abc transporter cassette
1l7v	Bacterial abc transporter involved in b12 uptake
1l8q	Crystal structure of dna replication initiation factor
1ls1	T. aquaticus ffh ng domain at 1.1a resolution
1lv7	Crystal structure of the aaa domain of ftsh
1mab	Rat liver f1-atpase
1mo3	Reca-adp complex
1mo4	Reca-atp-gamma-s complex
1mo5	Reca-atp-gamma-s-mg complex
1mo6	Reca-datp-mg complex
1mt0	Atp-binding domain of haemolysin b from escherichia coli
1mv5	Crystal structure of lmra atp-binding domain
1n03	Model for active reca filament
1n0w	Crystal structure of a rad51-brca2 brc repeat complex
1nbm	The structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan
1ng1	N and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
1njf	Nucleotide bound form of an isolated e. coli clamp loader gamma subunit
1njg	Nucleotide-free form of an isolated e. coli clamp loader gamma subunit
1nlf	Crystal structure of dna helicase repa in complex with sulfate at 1.95 a resolution
1nsf	D2 hexamerization domain of n-ethylmaleimide sensitive factor (nsf)
1ny5	Crystal structure of sigm54 activator (aaa+ atpase) in the inactive state
1ny6	Crystal structure of sigm54 activator (aaa+ atpase) in the active state
1o87	A new mggdp complex of the ffh ng domain
1ofh	Asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
1ofi	Asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
1ohh	Bovine mitochondrial f1-atpase complexed with the inhibitor protein if1
1ojl	Crystal structure of a sigma54-activator suggests the mechanism for the conformational switch necessary for sigma54 binding
1okk	Homo-heterodimeric complex of the srp gtpases
1olo	Hexameric replicative dna helicase repa from plasmid rsf1010 - cubic crystal structure
1oxs	Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
1oxt	Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
1oxu	Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
1oxv	Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
1oxx	Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
1p9r	Crystal structure of vibrio cholerae putative ntpase epse
1p9w	Crystal structure of vibrio cholerae putative ntpase epse
1pv4	X-ray crystal structure of the rho transcription termination factor in complex with single stranded dna
1pvo	X-ray crystal structure of rho transcription termination factor in complex with ssrna substrate and anppnp
1pzn	Rad51 (rada)
1q12	Crystal structure of the atp-bound e. coli malk
1q1b	Crystal structure of e. coli malk in the nucleotide-free form
1q1e	The atpase component of e. coli maltose transporter (malk) in the nucleotide-free form
1q3h	Mouse cftr nbd1 with amp.pnp
1qo1	Molecular architecture of the rotary motor in atp synthase from yeast mitochondria
1qvr	Crystal structure analysis of clpb
1qzw	Crystal structure of the complete core of archaeal srp and implications for inter-domain communication
1qzx	Crystal structure of the complete core of archaeal srp and implications for inter-domain communication
1r0w	Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) apo
1r0x	Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp
1r0y	Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with adp
1r0z	Phosphorylated cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp
1r10	Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp, i4122 space group
1r6b	High resolution crystal structure of clpa
1r7r	The crystal structure of murine p97/vcp at 3.6a
1rea	Structure of the reca protein-adp complex
1rj9	Structure of the heterodimer of the conserved gtpase domains of the signal recognition particle (ffh) and its receptor (ftsy)
1ry1	Structure of the signal recognition particle interacting with the elongation-arrested ribosome
1s3s	Crystal structure of aaa atpase p97/vcp nd1 in complex with p47 c
1sgw	Putative abc transporter (atp-binding protein) from pyrococcus furiosus pfu-867808-001
1sky	Crystal structure of the nucleotide free alpha3beta3 sub- complex of f1-atpase from the thermophilic bacillus ps3
1sxj	Crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)
1szp	A crystal structure of the rad51 filament
1t4g	Atpase in complex with amp-pnp
1u94	Crystal structure of e. coli reca in a compressed helical filament form 2
1u98	"crystal structure of e. coli reca in a compressed helical filament form3"
1u99	"crystal structures of e. coli reca in a compressed helical filament form 4"
1ubc	Structure of reca protein
1ube	Msreca-adp complex
1ubf	Msreca-atpgs complex
1ubg	Msreca-datp complex
1um8	Crystal structure of helicobacter pylori clpx
1v43	Crystal structure of atpase subunit of abc sugar transporter
1v5w	Crystal structure of the human dmc1 protein
1vci	Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp
1vdz	Crystal structure of a-type atpase catalytic subunit a from pyrococcus horikoshii ot3
1vma	Crystal structure of cell division protein ftsy (tm0570) from thermotoga maritima at 1.60 a resolution
1vpl	Crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution
1w0j	Beryllium fluoride inhibited bovine f1-atpase
1w0k	Beryllium fluoride inhibited bovine f1-atpase
1w36	Recbcd:dna complex
1xef	Crystal structure of the atp/mg2+ bound composite dimer of hlyb-nbd
1xf9	Structure of nbd1 from murine cftr- f508s mutant
1xfa	Structure of nbd1 from murine cftr- f508r mutant
1xmi	Crystal structure of human f508a nbd1 domain with atp
1xmj	Crystal structure of human deltaf508 human nbd1 domain with atp
1xms	"e. coli reca in complex with mnamp-pnp"
1xmv	"e. coli reca in complex with mgadp"
1xp8	"deinococcus radiodurans reca in complex with atp-gamma-s"
1xpo	Structural mechanism of inhibition of the rho transcription termination factor by the antibiotic bicyclomycin
1xpr	Structural mechanism of inhibition of the rho transcription termination factor by the antibiotic 5a-formylbicyclomycin (fb)
1xpu	Structural mechanism of inhibition of the rho transcription termination factor by the antibiotic 5a-(3- formylphenylsulfanyl)-dihydrobicyclomycin (fpdb)
1xu4	Atpase in complex with amp-pnp, magnesium and potassium co-f
1xwi	Crystal structure of vps4b
1xxh	Atpgs bound e. coli clamp loader complex
1xxi	Adp bound e. coli clamp loader complex
1ye8	Crystal structure of thep1 from the hyperthermophile aquifex aeolicus
1yqt	Rnase-l inhibitor
1yr6	Pab0955 crystal structure : a gtpase in apo form from pyrococcus abyssi
1yr7	Pab0955 crystal structure : a gtpase in gtp-gamma-s bound form from pyrococcus abyssi
1yr8	Pab0955 crystal structure : a gtpase in gtp bound form from pyrococcus abyssi
1yr9	Pab0955 crystal structure : a gtpase in gdp and po4 bound form from pyrococcus abyssi
1yra	Pab0955 crystal structure : a gtpase in gdp bound form from pyrococcus abyssi
1yrb	Pab0955 crystal structure : a gtpase in gdp and mg bound form from pyrococcus abyssi
1yyf	Correction of x-ray intensities from an hslv-hslu co- crystal containing lattice translocation defects
1z47	Structure of the atpase subunit cysa of the putative sulfate atp-binding cassette (abc) transporter from alicyclobacillus acidocaldarius
1zu4	Crystal structure of ftsy from mycoplasma mycoides- space group p21212
1zu5	Crystal structure of ftsy from mycoplasma mycoides- space group h32
2awn	Crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg)
2awo	Crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg)
2b21	Rada recombinase in complex with amppnp at ph 6.0
2bbo	Human nbd1 with phe508
2bbs	Human deltaf508 nbd1 with three solubilizing mutations
2bbt	Human deltaf508 nbd1 with two solublizing mutations.
2bjv	Crystal structure of pspf(1-275) r168a mutant
2bjw	Pspf aaa domain
2bke	Conformational flexibility revealed by the crystal structure of a crenarchaeal rada
2c03	Gdp complex of srp gtpase ffh ng domain
2c04	Gmppcp complex of srp gtpase ffh ng domain at ultra-high resolution
2c96	Structural basis of the nucleotide driven conformational changes in the aaa domain of transcription activator pspf
2c98	Structural basis of the nucleotide driven conformational changes in the aaa domain of transcription activator pspf
2c99	Structural basis of the nucleotide driven conformational changes in the aaa domain of transcription activator pspf
2c9c	Structural basis of the nucleotide driven conformational changes in the aaa domain of transcription activator pspf
2c9o	3d structure of the human ruvb-like helicase ruvbl1
2cbz	Structure of the human multidrug resistance protein 1 nucleotide binding domain 1
2ce7	Edta treated
2cea	Wildtype
2chg	Replication factor c domains 1 and 2
2chq	Replication factor c adpnp complex
2chv	Replication factor c adpnp complex
2ck3	Azide inhibited bovine f1-atpase
2cnw	Gdpalf4 complex of the srp gtpases ffh and ftsy
2d3w	Crystal structure of escherichia coli sufc, an atpase compenent of the suf iron-sulfur cluster assembly machinery
2d62	Crystal structure of multiple sugar binding transport atp- binding protein
2dfl	Crystal structure of left-handed rada filament
2dhr	Whole cytosolic region of atp-dependent metalloprotease ftsh (g399l)
2dpy	Crystal structure of the flagellar type iii atpase flii
2dr3	Crystal structure of reca superfamily atpase ph0284 from pyrococcus horikoshii ot3
2ewv	Crystal structure of the pilus retraction motor pilt and bound adp
2eww	Crystal structure of the pilus retraction motor pilt and bound atp
2eyu	The crystal structure of the c-terminal domain of aquifex aeolicus pilt
2f1h	Recombinase in complex with amp-pnp and potassium
2f1i	Recombinase in complex with amp-pnp
2f1j	Recombinase in complex with adp
2f43	Rat liver f1-atpase
2ff7	The abc-atpase of the abc-transporter hlyb in the adp bound state
2ffa	Crystal structure of abc-atpase h662a of the abc- transporter hlyb in complex with adp
2ffb	The crystal structure of the hlyb-nbd e631q mutant in complex with adp
2ffh	The signal sequence binding protein ffh from thermus aquaticus
2fgj	Crystal structure of the abc-cassette h662a mutant of hlyb with bound atp
2fgk	Crystal structure of the abc-cassette e631q mutant of hlyb with bound atp
2fpk	Rada recombinase in complex with adp
2fpl	Rada recombinase in complex with amp-pnp and low concentration of k+
2fpm	Rada recombinase in complex with amp-pnp and high concentration of k+
2g88	Msreca-datp complex
2gdj	Delta-62 rada recombinase in complex with amp-pnp and magnesium
2ghi	Crystal structure of plasmodium yoelii multidrug resistance protein 2
2gsz	Structure of a. aeolicus pilt with 6 monomers per asymmetric unit
2hcb	Structure of amppcp-bound dnaa from aquifex aeolicus
2hld	Crystal structure of yeast mitochondrial f1-atpase
2ht1	The closed ring structure of the rho transcription termination factor in complex with nucleic acid in the motor domains
2hyd	Multidrug abc transporter sav1866
2i1q	Rada recombinase in complex with calcium
2ihy	Structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter
2it1	Structure of ph0203 protein from pyrococcus horikoshii
2iw3	Elongation factor 3 in complex with adp
2iwh	Structure of yeast elongation factor 3 in complex with adpnp
2ix3	Structure of yeast elongation factor 3
2ix8	Model for eef3 bound to an 80s ribosome
2ixe	Crystal structure of the atpase domain of tap1 with atp (d645n mutant)
2ixf	Crystal structure of the atpase domain of tap1 with atp (d645q, q678h mutant)
2ixg	Crystal structure of the atpase domain of tap1 with atp (s621a, g622v, d645n mutant)
2iy3	Structure of the e. coli signal recognition particle bound to a translating ribosome
2iyl	Structure of an ftsy:gdp complex
2j28	Model of e. coli srp bound to 70s rncs
2j37	Model of mammalian srp bound to 80s rncs
2j45	Water structure of t. aquaticus ffh ng domain at 1.1a resolution
2j46	Water structure of t. aquaticus ffh ng domain at 1.1a resolution
2j7p	Gmppnp-stabilized ng domain complex of the srp gtpases ffh and ftsy
2jdi	Ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
2jiz	The structure of f1-atpase inhibited by resveratrol.
2jj1	The structure of f1-atpase inhibited by piceatannol.
2jj2	The structure of f1-atpase inhibited by quercetin.
2ng1	N and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
2nq2	An inward-facing conformation of a putative metal-chelate type abc transporter.
2o5v	Recombination mediator recf
2obl	Structural and biochemical analysis of a prototypical atpase from the type iii secretion system of pathogenic bacteria
2obm	Structural and biochemical analysis of a prototypical atpase from the type iii secretion system of pathogenic bacteria
2odn	Msreca-datp complex
2odw	Msreca-atp-gama-s complex
2oe2	Msreca-native-low humidity 95%
2oep	Msreca-adp-complex
2oes	Msreca-native-ssb
2ofo	Msreca-native
2og2	Crystal structure of chloroplast ftsy from arabidopsis thaliana
2olj	Abc protein artp in complex with adp/mg2+
2olk	Abc protein artp in complex with adp-beta-s
2onj	Structure of the multidrug abc transporter sav1866 from s. aureus in complex with amp-pnp
2onk	Abc transporter modbc in complex with its binding protein moda
2ouk	Abc protein artp in complex with sulphate
2oxr	Pab0955 crystal structure : a gtpase in gdp and mg bound form from pyrococcus abyssi (after gtp hydrolysis)
2p65	Crystal structure of the first nucleotide binding domain of chaperone clpb1, putative, (pv089580) from plasmodium vivax
2pcj	Crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5
2pcl	Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
2pjz	The crystal structure of putative cobalt transport atp- binding protein (cbio-2), st1066
2pmk	Crystal structures of an isolated abc-atpase in complex with tnp-adp
2pze	Minimal human cftr first nucleotide binding domain as a head-to-tail dimer
2pzf	Minimal human cftr first nucleotide binding domain as a head-to-tail dimer with delta f508
2pzg	Minimal human cftr first nucleotide binding domain as a monomer
2q0h	Abc protein artp in complex with adp/mg2+, atp-gamma-s hydrolyzed
2q9a	Structure of apo ftsy
2q9b	Structure of ftsy:gmppnp complex
2q9c	Structure of ftsy:gmppnp with mgcl complex
2qby	Crystal structure of a heterodimer of cdc6/orc1 initiators bound to origin dna (from s. solfataricus)
2qe7	Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1
2qi9	Abc-transporter btucd in complex with its periplasmic binding protein btuf
2qp9	Crystal structure of s.cerevisiae vps4
2qpa	Crystal structure of s.cerevisiae vps4 in the presence of adp
2qy9	Structure of the ng+1 construct of the e. coli srp receptor ftsy
2qz4	Human paraplegin, aaa domain in complex with adp
2r62	Crystal structure of helicobacter pylori atp dependent protease, ftsh
2r65	Crystal structure of helicobacter pylori atp dependent protease, ftsh adp complex
2r6a	Crystal form bh1
2r6c	Crystal form bh2
2r6d	Crystal form b1
2r6e	Crystal form b2
2r6f	Crystal structure of bacillus stearothermophilus uvra
2r6g	The crystal structure of the e. coli maltose transporter
2reb	The structure of the e. coli reca protein monomer and polymer
2rec	Reca hexamer model, electron microscopy
2rko	Crystal structure of the vps4p-dimer
2v1u	Structure of the aeropyrum pernix orc1 protein in complex with dna
2v3c	Crystal structure of the srp54-srp19-7s.s srp rna complex of m. jannaschii
2v7q	The structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
2vii	Pspf1-275-mg-amp
2vye	Crystal structure of the dnac-ssdna complex
2vyf	Crystal structure of the dnac
2w0m	Crystal structure of sso2452 from sulfolobus solfataricus p2
2w6e	Low resolution structures of bovine mitochondrial f1-atpase during controlled dehydration: hydration state 1.
2w6f	Low resolution structures of bovine mitochondrial f1-atpase during controlled dehydration: hydration state 2.
2w6g	Low resolution structures of bovine mitochondrial f1-atpase during controlled dehydration: hydration state 3.
2w6h	Low resolution structures of bovine mitochondrial f1-atpase during controlled dehydration: hydration state 4a.
2w6i	Low resolution structures of bovine mitochondrial f1-atpase during controlled dehydration: hydration state 4b.
2w6j	Low resolution structures of bovine mitochondrial f1-atpase during controlled dehydration: hydration state 5.
2wss	The structure of the membrane extrinsic region of bovine atp synthase
2www	Crystal structure of methylmalonic acidemia type a protein
2yyz	Crystal structure of sugar abc transporter, atp-binding protein
2yz2	Crystal structure of the abc transporter in the cobalt transport system
2z43	Structure of a twinned crystal of rada
2z4r	Crystal structure of domain iii from the thermotoga maritima replication initiation protein dnaa
2z4s	Crystal structure of domain iii from the thermotoga maritima replication initiation protein dnaa
2zam	Crystal structure of mouse skd1/vps4b apo-form
2zan	Crystal structure of mouse skd1/vps4b atp-form
2zao	Crystal structure of mouse skd1/vps4b adp-form
2zjb	Crystal structure of the human dmc1-m200v polymorphic variant
2zr0	Msreca-q196e mutant
2zr7	Msreca native form ii'
2zr9	Msreca q196e datp form iv
2zra	Msreca q196e atpgs
2zrb	Msreca q196e form ii'
2zrc	Msreca q196n form iv
2zrd	Msreca q196n adp form iv
2zre	Msreca q196n atpgs form iv
2zrf	Msreca q196n datp form iv
2zrg	Msreca q196n datp form ii'
2zrh	Msreca q196a form iv
2zri	Msreca q196a adp form iv
2zrj	Msreca q196a atpgs form iv
2zrk	Msreca q196a datp form iv
2zrl	Msreca q196a datp form ii'
2zrm	Msreca datp form iv
2zrn	Msreca form iv
2zro	Msreca adp form iv
2zrp	Msreca datp form ii'
2zts	Crystal structure of kaic-like protein ph0186 from hyperthermophilic archaea pyrococcus horikoshii ot3
2zu0	Crystal structure of sufc-sufd complex involved in the iron- sulfur cluster biosynthesis
2zub	Left handed rada
2zuc	Crystal structure of left-handed rada filament
2zud	Crystal structure of left-handed rada filament
3b5j	Crystal structures of the s504a mutant of an isolated abc- atpase in complex with tnp-adp
3b5w	Crystal structure of eschericia coli msba
3b5x	Crystal structure of msba from vibrio cholerae
3b5y	Crystal structure of msba from salmonella typhimurium with amppnp
3b5z	Crystal structure of msba from salmonella typhimurium with adp vanadate
3b60	Crystal structure of msba from salmonella typhimurium with amppnp, higher resolution form
3b9p	Spastin
3b9q	The crystal structure of cpftsy from arabidopsis thaliana
3bk7	Structure of the complete abce1/rnaase-l inhibitor protein from pyrococcus abysii
3c41	Abc protein artp in complex with amp-pnp/mg2+
3c4j	Abc protein artp in complex with atp-gamma-s
3cf0	Structure of d2 subdomain of p97/vcp in complex with adp
3cf1	Structure of p97/vcp in complex with adp/adp.alfx
3cf2	Structure of p97/vcp in complex with adp/amp-pnp
3cf3	Structure of p97/vcp in complex with adp
3cmt	Mechanism of homologous recombination from the reca- ssdna/dsdna structures
3cmu	Mechanism of homologous recombination from the reca- ssdna/dsdna structures
3cmv	Mechanism of homologous recombination from the reca- ssdna/dsdna structures
3cmw	Mechanism of homologous recombination from the reca- ssdna/dsdna structures
3cmx	Mechanism of homologous recombination from the reca- ssdna/dsdna structures
3d31	Modbc from methanosarcina acetivorans
3d8b	Crystal structure of human fidgetin-like protein 1 in complex with adp
3dhw	Crystal structure of methionine importer metni
3dm5	Structures of srp54 and srp19, the two proteins assembling the ribonucleic core of the signal recognition particle from the archaeon pyrococcus furiosus.
3dm9	Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
3dmd	Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
3dzd	Crystal structure of sigma54 activator ntrc4 in the inactive state
3e1s	Structure of an n-terminal truncation of deinococcus radiodurans recd2
3e70	Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
3ec2	Crystal structure of the dnac helicase loader
3ecc	Crystal structure of the dnac helicase loader in complex with adp-bef3
3eie	Crystal structure of s.cerevisiae vps4 in the so4-bound state
3eih	Crystal structure of s.cerevisiae vps4 in the presence of atpgammas
3etl	Rada recombinase from methanococcus maripaludis in complex with amppnp
3ew9	Rada recombinase from methanococcus maripaludis in complex with amppnp and potassium ions
3ewa	Rada recombinase from methanococcus maripaludis in complex with amppnp and ammonium ions
3f9v	Crystal structure of a near full-length archaeal mcm: functional insights for an aaa+ hexameric helicase
3fh6	Crystal structure of the resting state maltose transporter from e. coli
3fks	Yeast f1 atpase in the absence of bound nucleotides
3fvq	Crystal structure of the nucleotide binding domain fbpc complexed with atp
3fyh	Recombinase in complex with adp and metatungstate
3g5u	Structure of p-glycoprotein reveals a molecular basis for poly-specific drug binding
3g60	Structure of p-glycoprotein reveals a molecular basis for poly-specific drug binding
3g61	Structure of p-glycoprotein reveals a molecular basis for poly-specific drug binding
3gfo	Structure of cbio1 from clostridium perfringens: part of the abc transporter complex cbionq.
3glf	Crystal structure of the ecoli clamp loader bound to primer- template dna
3glg	Crystal structure of a mutant (gammat157a) e. coli clamp loader bound to primer-template dna
3glh	Crystal structure of the e. coli clamp loader bound to psi peptide
3gli	Crystal structure of the e. coli clamp loader bound to primer-template dna and psi peptide
3gp8	Crystal structure of the binary complex of recd2 with dna
3gpl	Crystal structure of the ternary complex of recd2 with dna and adpnp
3h4m	Aaa atpase domain of the proteasome- activating nucleotidase
3hte	Crystal structure of nucleotide-free hexameric clpx
3hws	Crystal structure of nucleotide-bound hexameric clpx
3ice	Rho transcription termination factor bound to rna and adp- bef3
3k70	Crystal structure of the complete initiation complex of recbcd
3ng1	N and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

Links (links to other resources describing this domain)

• PFAM: AAA
• INTERPRO: IPR003593
• PROSITE: AAA