The domain within your query sequence starts at position 228 and ends at position 309; the E-value for the AARP2CN domain shown below is 1.14e-28.

ESGMLLRQLANQKQRHLAFRDRRAYLFAHVADFVPSEESDLVGTLKISGYVRGRTLNVNS
LLHIVGHGDFQMNQIDAPVDPF

AARP2CN

AARP2CN (NUC121) domain
AARP2CN
SMART accession number:SM00785
Description: This domain is the central domain of AARP2. It is weakly similar to the GTP-binding domain of elongation factor TU (PUBMED:15112237).
Interpro abstract (IPR012948):

This domain is the central domain of AARP2 (asparagine and aspartate rich protein 2). It is weakly similar to the GTP-binding domain of elongation factor TU [ (PUBMED:15112237) ]. PfAARP2 is an antigen from Plasmodium falciparum of 150kDa, which is encoded by a unique gene on chromosome 1 [ (PUBMED:9247928) ]. The central region of Pfaarp2 contains blocks of repetitions encoding asparagine and aspartate residues.

GO process:ribosome biogenesis (GO:0042254)
GO component:nucleus (GO:0005634)
Family alignment:
View or

There are 3353 AARP2CN domains in 3350 proteins in SMART's nrdb database.

Click on the following links for more information.