The domain within your query sequence starts at position 78 and ends at position 165; the E-value for the AD domain shown below is 5.73e-38.

PLASLNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVM
EEVVITPPYQVENCKGKEGSALSHVRKI

AD

Anticodon-binding domain
AD
SMART accession number:SM00995
Description: This domain of approximately 100 residues is conserved from plants to humans. It is frequently found in association with Lsm domain-containing proteins.
Interpro abstract (IPR019181):

This domain of approximately 100 residues is conserved from plants to humans. It is an anticodon-binding domain of a prolyl-tRNA synthetase [ (PUBMED:11399074) ]. It is found in Lms12 and homologues. Lsm12 is a protein possibly involved in mRNA degradation or tRNA splicing [ (PUBMED:15225602) ].

Family alignment:
View or

There are 1170 AD domains in 1170 proteins in SMART's nrdb database.

Click on the following links for more information.