The domain within your query sequence starts at position 135 and ends at position 462; the E-value for the AICARFT_IMPCHas domain shown below is 4.84e-132.

AAKNHARVTVVCEPEDYAGVAAEMHGSDSKDTSLETRRHLALKAFTHTAQYDEAISDYFR
KQYSKGISQMPLRYGMNPHQTPAQLYTLKPKLPITVLNGAPGFINLCDALNAWQLVTELR
GAVDIPAAASFKHVSPAGAAVGVPLSEDEARVCMVYDLYPTLTPLAVAYARARGADRMSS
FGDFVALSDICDVPTAKIISREVSDGIVAPGYEEEALKILSKKKNGNYCVLQMDQSYKPD
ENEVRTLFGLRLSQKRNNGVVDKSLFSNIVTKNKDLPESALRDLIVATVAVKYTQSNSVC
YAKDGQVIGIGAGQQSRIHCTRLAGDKA

AICARFT_IMPCHas

AICARFT/IMPCHase bienzyme
AICARFT_IMPCHas
SMART accession number:SM00798
Description: This is a family of bifunctional enzymes catalysing the last two steps in de novo purine biosynthesis. The bifunctional enzyme is found in both prokaryotes and eukaryotes. The second last step is catalysed by 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase (AICARFT), this enzyme catalyses the formylation of AICAR with 10-formyl-tetrahydrofolate to yield FAICAR and tetrahydrofolate. The last step is catalysed by IMP (Inosine monophosphate) cyclohydrolase (IMPCHase), cyclizing FAICAR (5-formylaminoimidazole-4-carboxamide ribonucleotide) to IMP.
Interpro abstract (IPR002695):

This is a family of bifunctional enzymes catalysing the last two steps in de novo purine biosynthesis. The bifunctional enzyme is found in both prokaryotes and eukaryotes. The second last step is catalysed by 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase EC 2.1.2.3 (AICARFT), this enzyme catalyses the formylation of AICAR with 10-formyl-tetrahydrofolate to yield FAICAR and tetrahydrofolate [ (PUBMED:9332377) ]. The last step is catalysed by IMP (Inosine monophosphate) cyclohydrolase EC 3.5.4.10 (IMPCHase), cyclizing FAICAR (5-formylaminoimidazole-4-carboxamide ribonucleotide) to IMP [ (PUBMED:9332377) ].

GO process:purine nucleotide biosynthetic process (GO:0006164)
GO function:IMP cyclohydrolase activity (GO:0003937), phosphoribosylaminoimidazolecarboxamide formyltransferase activity (GO:0004643)
Family alignment:
View or

There are 21969 AICARFT_IMPCHas domains in 21968 proteins in SMART's nrdb database.

Click on the following links for more information.