The domain within your query sequence starts at position 18 and ends at position 155; the E-value for the AMP_N domain shown below is 2.71e-39.

VPLALFALNRQRLCERLRKNGAVQAASAVVLQGGEEMQRYCTDTSIIFRQESFFHWAFGV
VESGCYGVIDVDTGKSTLFVPRLPDSYATWMGKIHSKEYFKEKYAVDDVQYTDEIASVLT
SRNPSVLLTLRGVNTDSG

AMP_N

Aminopeptidase P, N-terminal domain
AMP_N
SMART accession number:SM01011
Description: This domain is structurally very similar to the creatinase N-terminal domain. However, little or no sequence similarity exists between the two families.
Interpro abstract (IPR007865):

This entry represents the N-terminal domain of aminopeptidase P (X-Pro aminopeptidase I,II and III EC 3.4.11.9) and related sequences belonging to the peptidase M24B family. The domain is structurally very similar [(PUBMED:9520390)] to the creatinase N-terminal domain (IPR000587).

GO function:aminopeptidase activity (GO:0004177), manganese ion binding (GO:0030145)
Family alignment:
View or

There are 15332 AMP_N domains in 15331 proteins in SMART's nrdb database.

Click on the following links for more information.