The domain within your query sequence starts at position 215 and ends at position 267; the E-value for the ANX domain shown below is 1.6e-22.

GTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYL

ANX

Annexin repeats
ANX
SMART accession number:SM00335
Description: -
Interpro abstract (IPR018502):

The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [(PUBMED:1646719)]. The 12 annexins common to vertebrates are classified in the annexin A family and named as annexins A1-A13 (or ANXA1-ANXA13), leaving A12 unassigned in the official nomenclature. Annexins outside vertebrates are classified into families B (in invertebrates), C (in fungi and some groups of unicellular eukaryotes), D (in plants), and E (in protists) [(PUBMED:15059252)]. Annexins are absent from yeasts and prokaryotes [(PUBMED:15059252)].

Most eukaryotic species have 1-20 annexin (ANX) genes. All annexins share a core domain made up of four similar repeats, each approximately 70 amino acids long [(PUBMED:1646719)]. Each individual annexin repeat (sometimes referred to as endonexin folds) is folded into five alpha-helices, and in turn are wound into a right-handed super-helix; they usually contain a characteristic 'type 2' motif for binding calcium ions with the sequence 'GxGT-[38 residues]-D/E'. Animal and fungal annexins also have variable amino-terminal domains. The core domains of most vertebrate annexins have been analysed by X-ray crystallography, revealing conservation of their secondary and tertiary structures despite only 45-55% amino-acid identity among individual members. The four repeats pack into a structure that resembles a flattened disc, with a slightly convex surface on which the Ca 2+ -binding loops are located and a concave surface at which the amino and carboxyl termini come into close apposition.

Annexins are traditionally thought of as calcium-dependent phospholipid-binding proteins, but recent work suggests a more complex set of functions. The famiy has been linked with inhibition of phospholipase activity, exocytosis and endoctyosis, signal transduction, organisation of the extracellular matrix, resistance to reactive oxygen species and DNA replication [(PUBMED:9797403)].

GO function:calcium-dependent phospholipid binding (GO:0005544), calcium ion binding (GO:0005509)
Family alignment:
View or

There are 33454 ANX domains in 9551 proteins in SMART's nrdb database.

Click on the following links for more information.