The domain within your query sequence starts at position 822 and ends at position 969; the E-value for the AP3B1_C domain shown below is 1.58e-78.

PPSKDVFLLDLDDFNPVSTPVALPTPALSPSLIADLEGLNLSTSSSVINVSTPVFVPTKT
HELLHRMHGKGLAAHYCFPRQPCIFSDKMVSVQITLTNTSDRKIENIHIGGKGLPVGMQM
HAFHPIDSLEPKGSVTVSVGIDFCDSTQ

AP3B1_C

Clathrin-adaptor complex-3 beta-1 subunit C-terminal
AP3B1_C
SMART accession number:SM01355
Description: This domain lies at the C-terminus of the clathrin-adaptor protein complex-3 beta-1 subunit. The AP-3 complex is associated with the Golgi region of the cell as well as with more peripheral structures. The AP-3 complex may be directly involved in trafficking to lysosomes or alternatively it may be involved in another pathway, but that mis-sorting in that pathway may indirectly lead to defects in pigment granules (PMID:10024875).
Interpro abstract (IPR029390):

This domain lies at the C terminus of the clathrin-adaptor protein complex-3 beta-1 subunit. The AP-3 complex is associated with the Golgi region of the cell, as well as with more peripheral structures. Loss of functional AP-3 complex leads to defects in the function of lysosomes and lysosome-related organelles [ (PUBMED:10024875) ]. The AP-3 complex seems to be involved in the trafficking of lysosomal membrane proteins from endosomes [ (PUBMED:15051738) ].

Family alignment:
View or

There are 1193 AP3B1_C domains in 1191 proteins in SMART's nrdb database.

Click on the following links for more information.