The domain within your query sequence starts at position 524 and ends at position 682; the E-value for the APC10 domain shown below is 1.11e-18.

LKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITINCVKGINARYVSVH
VDNSRDLGNKVTSMTFLTGKAVEELCRIKQVDLDSRHIGWVTSELPGGDNQIIKIELKGP
ENTLRVRQVKVLGWKDGESTKIAGQISASVAQQRSCEAE

APC10

Anaphase-promoting complex, subunit 10 (APC10)
APC10
SMART accession number:SM01337
Description: -
Interpro abstract (IPR004939):

The anaphase-promoting complex (APC) or cyclosome is a multi-subunit E3 protein ubiquitin ligase that regulates important events in mitosis, such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins, thereby targeting them for proteolysis by the 26S proteasome.

One of the subunits of the APC that is required for ubiquitination activity is APC10, a one-domain protein homologous to a sequence element, termed the DOC domain, found in several hypothetical proteins that may also mediate ubiquitination reactions, because they contain combinations of either RING finger cullin or HECT domains [(PUBMED:10318877), (PUBMED:11524682), (PUBMED:11884135)].

The DOC domain consists of a beta-sandwich, in which a five-stranded antiparallel beta-sheet is packed on top of a three stranded antiparallel beta-sheet, exhibiting a 'jellyroll' fold [(PUBMED:11524682), (PUBMED:11884135)].

Proteins known to contain a DOC domain include:

  • Eucaryotic Doc1/Apc10.
  • Mammalian protein associated with the transcription factor Myc (PAM).
  • Mouse runty-jerky-sterile (RJS) protein.
  • Human HERC2, the ortholog of RJS.

Family alignment:
View or

There are 4716 APC10 domains in 4712 proteins in SMART's nrdb database.

Click on the following links for more information.