The domain within your query sequence starts at position 284 and ends at position 500; the E-value for the APCDDC domain shown below is 6.26e-91.

KADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFTIYA
RGRYSRGVLSSKVMGGTEFVFKVNHMKVTPMDAATASLLNVFSGNECGAEGSWQVGIQQD
VTHTNGCVALGIKLPHTEYEIFKMEQDTRGRYLLFNGQRPSDGSSPDRPEKRATSYQMPL
VQCASSSPRAEELLEDSQGHLYGRAAGRTAGSLLLPA

APCDDC

Adenomatosis polyposis coli down-regulated 1
APCDDC
SMART accession number:SM01352
Description: The domain is duplicated in most members of this family. APCDD is directly regulated by the beta-catenin/Tcf complex, and its elevated expression promotes proliferation of colonic epithelial cells in vitro and in vivo (PMID:12384519). APCDD1 has an N-terminal signal-peptide and a C-terminal transmembrane region. The domain is rich in cysteines, there being up to 12 such residues, a structural motif important for interaction between Wnt ligands and their receptors. APCDD1 is expressed in a broad repertoire of cell types, indicating that it may regulate a diverse range of biological processes controlled by Wnt signalling (PMID:20393562).
Interpro abstract (IPR029405):

APCDD1 is directly regulated by the beta-catenin/Tcf complex, and its elevated expression promotes proliferation of colonic epithelial cells in vitro and in vivo [ (PUBMED:12384519) ]. APCDD1 has an N-terminal signal-peptide and a C-terminal transmembrane region. This domain is duplicated in most members of the family. The domain is rich in cysteines, there being up to 12 such residues, a structural motif important for interaction between Wnt ligands and their receptors. APCDD1 is expressed in a broad repertoire of cell types, indicating that it may regulate a diverse range of biological processes controlled by Wnt signalling [ (PUBMED:20393562) ].

Family alignment:
View or

There are 1316 APCDDC domains in 735 proteins in SMART's nrdb database.

Click on the following links for more information.