The domain within your query sequence starts at position 1096 and ends at position 1147; the E-value for the AWS domain shown below is 2.61e-17.

SEIPRCNCKPGDENPCGLESQCLNRMSQYECHPQVCPAGDRCQNQCFTKRLY

AWS

associated with SET domains

• SMART accession number: SM00570
• Description: subdomain of PRESET
• Interpro abstract (IPR006560):

  This domain, Associated With SET, of unknown function is found in eukaryotic proteins of unknown function. This domain, as the name suggests, is often found in association with the SET domain (IPR001214), suggesting a role in gene regulation by methylation of lysine residues in histones and other proteins.

• GO component: nucleus (GO:0005634)
• GO function: histone-lysine N-methyltransferase activity (GO:0018024)

There are 335 AWS domains in 335 proteins in SMART's nrdb database.

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Doerks T, Copley RR, Schultz J, Ponting CP, Bork P
• Systematic identification of novel protein domain families associated with nuclear functions.
• Genome Res. 2002; 12: 47-56

A systematic computational analysis of protein sequences containing known nuclear domains led to the identification of 28 novel domain families. This represents a 26% increase in the starting set of 107 known nuclear domain families used for the analysis. Most of the novel domains are present in all major eukaryotic lineages, but 3 are species specific. For about 500 of the 1200 proteins that contain these new domains, nuclear localization could be inferred, and for 700, additional features could be predicted. For example, we identified a new domain, likely to have a role downstream of the unfolded protein response; a nematode-specific signalling domain; and a widespread domain, likely to be a noncatalytic homolog of ubiquitin-conjugating enzymes.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
66.67	map04530	Tight junction
33.33	map00310	Lysine degradation

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with AWS domain which could be assigned to a KEGG orthologous group, and not all proteins containing AWS domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of AWS domains in PDB

PDB code	Title
3h6l	Methyltransferase domain of human set domain-containing protein 2

Links (links to other resources describing this domain)

• INTERPRO: IPR006560