The domain within your query sequence starts at position 1096 and ends at position 1147; the E-value for the AWS domain shown below is 2.61e-17.

SEIPRCNCKPGDENPCGLESQCLNRMSQYECHPQVCPAGDRCQNQCFTKRLY

AWS

associated with SET domains
AWS
SMART accession number:SM00570
Description: subdomain of PRESET
Interpro abstract (IPR006560):

This domain, Associated With SET, of unknown function is found in eukaryotic proteins of unknown function. This domain, as the name suggests, is often found in association with the SET domain (IPR001214), suggesting a role in gene regulation by methylation of lysine residues in histones and other proteins.

GO component:nucleus (GO:0005634)
GO function:histone-lysine N-methyltransferase activity (GO:0018024)
Family alignment:
View or

There are 1088 AWS domains in 1086 proteins in SMART's nrdb database.

Click on the following links for more information.