The domain within your query sequence starts at position 6 and ends at position 127; the E-value for the Agouti domain shown below is 3.98e-69.

LLLATLVGFLCFFTVHSHLALEETLGDDRSLRSNSSMNSLDFSSVSIVALNKKSKKISRK
EAEKRKRSSKKKASMKKVARPPPPSPCVATRDSCKPPAPACCDPCASCQCRFFGSACTCR
VL

Agouti

Agouti protein
Agouti
SMART accession number:SM00792
Description: The agouti protein regulates pigmentation in the mouse hair follicle producing a black hair with a subapical yellow band. A highly homologous protein agouti signal protein (ASIP) is present in humans and is expressed at highest levels in adipose tissue where it may play a role in energy homeostasis and possibly human pigmentation (PUBMED:11837451), (PUBMED:11833005).
Interpro abstract (IPR007733):

The agouti protein regulates pigmentation in the mouse hair follicle producing a black hair with a subapical yellow band. A highly homologous protein agouti signal protein (ASIP) is present in humans and is expressed at highest levels in adipose tissue where it may play a role in energy homeostasis and possibly human pigmentation [ (PUBMED:11837451) (PUBMED:11833005) ]. This family also includes the Agouti-related protein (Agrp), involved in energy balance, body weight regulation and metabolism. It interacts with melanocortin receptors MC3R, MC4R and MC5R [ (PUBMED:9892020) ].

GO process:hormone-mediated signaling pathway (GO:0009755)
GO component:extracellular region (GO:0005576)
Family alignment:
View or

There are 669 Agouti domains in 669 proteins in SMART's nrdb database.

Click on the following links for more information.