The domain within your query sequence starts at position 208 and ends at position 375; the E-value for the AlaDh_PNT_C domain shown below is 1.27e-39.

ANHFGRFFTGQITAAGKVPPAKILIVGGGVAGLASAGAAKSMGAVVRGFDTRAAALEQFK
SLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGGFLVT
QRMLDMFKRPTDPPEYNYLYLLPGGTFVGGYLAALYGGYNIEEIMYLG

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain
AlaDh_PNT_C
SMART accession number:SM01002
Description: Alanine dehydrogenase catalyzes the NAD-dependent reversible reductive amination of pyruvate into alanine.
Interpro abstract (IPR007698):

Alanine dehydrogenase catalyses the NAD-dependent reversible reductive amination of pyruvate into alanine. Pyridine nucleotide transhydrogenase catalyses the reduction of NADP + to NADPH with the concomitant oxidation of NADH to NAD + . This enzyme is located in the plasma membrane of prokaryotes and in the inner membrane of the mitochondria of eukaryotes. The transhydrogenation between NADH and NADP is coupled with the translocation of a proton across the membrane. In prokaryotes the enzyme is composed of two different subunits, an alpha chain (gene pntA) and a beta chain (gene pntB), while in eukaryotes it is a single chain protein.

The sequence of alanine dehydrogenase from several bacterial species is related with that of the alpha subunit of bacterial pyridine nucleotide transhydrogenase and the N-terminal half of the eukaryotic enzyme. The two most conserved regions correspond respectively to the N-terminal domain of these proteins, and to a central glycine-rich region which is part of the NAD(H)-binding site [ (PUBMED:8439307) ]. This entry represents a domain found in alanine dehydrogenase and pyridine nucleotide transhydrogenase, containing the glycine-rich region. This domain is also found in lysine 2-oxoglutarate reductases [ (PUBMED:11354603) ].

Family alignment:
View or

There are 28178 AlaDh_PNT_C domains in 28174 proteins in SMART's nrdb database.

Click on the following links for more information.