The domain within your query sequence starts at position 27 and ends at position 157; the E-value for the AlaDh_PNT_N domain shown below is 2.76e-22.

ALRREDVNAWERRAPLAPKHIKGITKLGYKVLIQPSNRRAIHDKEYVRAGGILQEDITEA
CLILGVKRPPEEKLMSKKTYAFFSHTIKAQEANMNLLDEVLKQEIRLIDYEKMVDHRGSR
IVAFGQWAGVA

AlaDh_PNT_N

Alanine dehydrogenase/PNT, N-terminal domain
AlaDh_PNT_N
SMART accession number:SM01003
Description: Alanine dehydrogenase catalyzes the NAD-dependent reversible reductive amination of pyruvate into alanine.
Interpro abstract (IPR007886):

Alanine dehydrogenase catalyses the NAD-dependent reversible reductive amination of pyruvate into alanine. Pyridine nucleotide transhydrogenase catalyses the reduction of NADP + to NADPH with the concomitant oxidation of NADH to NAD + . This enzyme is located in the plasma membrane of prokaryotes and in the inner membrane of the mitochondria of eukaryotes. The transhydrogenation between NADH and NADP is coupled with the translocation of a proton across the membrane. In prokaryotes the enzyme is composed of two different subunits, an alpha chain (gene pntA) and a beta chain (gene pntB), while in eukaryotes it is a single chain protein.

The sequence of alanine dehydrogenase from several bacterial species is related to the alpha subunit of bacterial pyridine nucleotide transhydrogenase and the N-terminal half of the eukaryotic enzyme. The two most conserved regions correspond respectively to the N-terminal domain of these proteins, represented in this entry, and to a central glycine-rich domain which is part of the NAD(H)-binding site [ (PUBMED:8439307) ]. The N-terminal domain is also found in lysine 2-oxoglutarate reductases [ (PUBMED:11354603) ].

Family alignment:
View or

There are 29418 AlaDh_PNT_N domains in 29415 proteins in SMART's nrdb database.

Click on the following links for more information.