The domain within your query sequence starts at position 21 and ends at position 100; the E-value for the Alpha-mann_mid domain shown below is 1.22e-32.

ELHNGTYTTHAQLKKGNRECEQILHDVEVLSSLALARSAQFLYPAAQLQHLWRLLLLNQF
HDVVTGSCIQLVAEDAMNYY

Alpha-mann_mid

Alpha mannosidase, middle domain
Alpha-mann_mid
SMART accession number:SM00872
Description: Members of this entry belong to the glycosyl hydrolase family 38, This domain, which is found in the central region adopts a structure consisting of three alpha helices, in an immunoglobulin/albumin-binding domain-like fold. The domain is predominantly found in the enzyme alpha-mannosidase (PUBMED:12634058).
Interpro abstract (IPR015341):

This entry represents a domain found in members of the glycosyl hydrolases families 38. This domain is found in the central region that adopts a structure consisting of three alpha helices, in an immunoglobulin/albumin-binding domain-like fold. The domain is predominantly found in the enzyme alpha-mannosidase [ (PUBMED:12634058) ].

Glycoside hydrolase family 38 comprises enzymes with only one known activity; alpha-mannosidase ( EC 3.2.1.24 ) ( EC 3.2.1.114 ).

Lysosomal alpha-mannosidase is necessary for the catabolism of N-linked carbohydrates released during glycoprotein turnover. The enzyme catalyses the hydrolysis of terminal, non-reducing alpha-D-mannose residues in alpha-D-mannosides, and can cleave all known types of alpha-mannosidic linkages. Defects in the gene cause lysosomal alpha-mannosidosis (AM), a lysosomal storage disease characterised by the accumulation of unbranched oligo-saccharide chains.

GO process:mannose metabolic process (GO:0006013)
GO function:alpha-mannosidase activity (GO:0004559)
Family alignment:
View or

There are 12985 Alpha-mann_mid domains in 12964 proteins in SMART's nrdb database.

Click on the following links for more information.