The domain within your query sequence starts at position 914 and ends at position 1032; the E-value for the BAH domain shown below is 1.33e-45.

SMYHVGDYVYVEPAEANLQPHIVCIERLWEDSAGEKWLYGCWFYRPNETFHLATRKFLEK
EVFKSDYYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRYSAKTKSFKKIK

BAH

Bromo adjacent homology domain
BAH
SMART accession number:SM00439
Description: -
Interpro abstract (IPR001025):

The BAH (bromo-adjacent homology) is commonly found in chromatin-associated proteins [ (PUBMED:23907388) ]. It is found in proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation. The BAH domain appears to act as a protein-protein interaction module specialised in gene silencing, as suggested for example by its interaction within yeast Orc1p with the silent information regulator Sir1p. The BAH module might therefore play an important role by linking DNA methylation, replication and transcriptional regulation [ (PUBMED:10100640) ].

GO function:chromatin binding (GO:0003682)
Family alignment:
View or

There are 12785 BAH domains in 10544 proteins in SMART's nrdb database.

Click on the following links for more information.