The domain within your query sequence starts at position 23 and ends at position 191; the E-value for the BCS1_N domain shown below is 1.29e-86.

VGVGTALAMARKGAQLGLVAFRRHYMITLEVPARDRSYAWLLSWLTRHSTRTQHLSVETS
YLQHESGRISTKFEFIPSPGNHFIWYQGKWIRVERNRDMQMVDLQTGTPWESVTFTALGT
DRKVFFNILEEARALALQQEEGKTVMYTAVGSEWRTFGYPRRRRPLDSV

BCS1_N

BCS1_N
SMART accession number:SM01024
Description: This domain is found at the N terminal of the mitochondrial ATPase BSC1. It encodes the import and intramitochondrial sorting for the protein.
Interpro abstract (IPR014851):

This domain is found at the N-terminal of the mitochondrial ATPase BSC1. This domain is responsible for the import and intramitochondrial sorting [ (PUBMED:12640110) ].

Family alignment:
View or

There are 2706 BCS1_N domains in 2706 proteins in SMART's nrdb database.

Click on the following links for more information.