The domain within your query sequence starts at position 1856 and ends at position 2009; the E-value for the BP28CT domain shown below is 2.25e-77.

KEELLSHQSQLTTFFLEALDFRAQHSEDDLEEVGKTEGWIIDCLVAMVVKLSEVTFRPLF
FKLFDWAKTEDAPKDRLLTFYNLADCIAEKLKGLFTLFAGHLVKPFADTLNQVNISKTDE
AFFDSERDPEKCCLLLQFILNCLYKVFLFDTQNF

BP28CT

BP28CT (NUC211) domain
BP28CT
SMART accession number:SM01036
Description: This C-terminal domain is found in BAP28-like nucleolar proteins (PUBMED:15112237).
Interpro abstract (IPR012954): This domain is found in the C-terminal of BAP28 proteins [(PUBMED:15112237)] (which are involved in nucleolar processing of pre-18S ribosomal RNA and ribosome biosynthesis [(PUBMED:16531401)]) and in other BAP28-like proteins.
Family alignment:
View or

There are 1342 BP28CT domains in 1339 proteins in SMART's nrdb database.

Click on the following links for more information.