The domain within your query sequence starts at position 2 and ends at position 80; the E-value for the BRCT domain shown below is 1.37e-2.

EDSATKHIIQMTGFKMEEKEALVKLLLKLDCTFIKSEKYKNCTHLIAERLCKSEKFLAAC
AAGKWVLTKDYIIHSAKSG

BRCT

breast cancer carboxy-terminal domain
BRCT
SMART accession number:SM00292
Description: -
Interpro abstract (IPR001357):

The breast cancer susceptibility gene contains at its C terminus two copies of a conserved domain that was named BRCT for BRCA1 C terminus. This domain of about 95 amino acids is found in a large variety of proteins involved in DNA repair, recombination and cell cycle control [(PUBMED:8673121), (PUBMED:9034168), (PUBMED:9000507)]. The BRCT domain is not limited to the C-terminal of protein sequences and can be found in multiple copies or in a single copy as in RAP1 and TdT. Some data [(PUBMED:9799248)] indicate that the BRCT domain functions as a protein-protein interaction module.

The structure of the first of the two C-terminal BRCT domains of the human DNA repair protein XRCC1 has recently been determined by X-ray crystallography [(PUBMED:9799248)].

Family alignment:
View or

There are 72534 BRCT domains in 52588 proteins in SMART's nrdb database.

Click on the following links for more information.