The domain within your query sequence starts at position 186 and ends at position 335; the E-value for the BTD domain shown below is 8.01e-92.

LCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVR
DGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYL
CLSQERIIQFQATPCPKEQNKEMINDGASW

BTD

Beta-trefoil DNA-binding domain
BTD
SMART accession number:SM01268
Description: Members of this family of DNA binding domains adopt a beta-trefoil fold, that is, a capped beta-barrel with internal pseudo threefold symmetry. In the DNA-binding protein LAG-1, it also is the site of mutually exclusive interactions with NotchIC (and the viral protein EBNA2) and co-repressors (SMRT/N-Cor and CIR) (PUBMED:15297877).
Interpro abstract (IPR015350):

This DNA-binding domain adopts a beta-trefoil fold, that is, a capped beta-barrel with internal pseudo threefold symmetry. In the DNA-binding protein LAG-1, it also is the site of mutually exclusive interactions with NotchIC (and the viral protein EBNA2) and corepressors (SMRT/N-Cor and CIR) [ (PUBMED:15297877) ].

GO process:regulation of transcription by RNA polymerase II (GO:0006357)
GO function:RNA polymerase II cis-regulatory region sequence-specific DNA binding (GO:0000978)
Family alignment:
View or

There are 1505 BTD domains in 1502 proteins in SMART's nrdb database.

Click on the following links for more information.