The domain within your query sequence starts at position 27 and ends at position 104; the E-value for the BTP domain shown below is 1.76e-32.

YHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQP
TLSDIVVTLVEMGFNVDT

BTP

Bromodomain transcription factors and PHD domain containing proteins
BTP
SMART accession number:SM00576
Description: subdomain of archael histone-like transcription factors
Interpro abstract (IPR006565):

This domain is found in eukaryotic bromodomain containing transcription factors and PHD domain containing proteins ( IPR001965 ). This domain has a histone-like fold and is predicted to bind DNA [ (PUBMED:11779830) ].

Family alignment:
View or

There are 2233 BTP domains in 2233 proteins in SMART's nrdb database.

Click on the following links for more information.