The domain within your query sequence starts at position 223 and ends at position 341; the E-value for the Beta-Casp domain shown below is 6.94e-37.

AQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFITWTNQKIRKTFVQRNMFEFKH
IKAFDRTFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKI

Beta-Casp

Beta-Casp domain
Beta-Casp
SMART accession number:SM01027
Description: The beta-CASP domain is found C terminal to the beta-lactamase domain in pre-mRNA 3'-end-processing endonuclease. The active site of this enzyme is located at the interface of these two domains.
Interpro abstract (IPR022712):

The beta-CASP domain is found C-terminal to the beta-lactamase domain in pre-mRNA 3'-end-processing endonuclease. The active site of this enzyme is located at the interface of these two domains [ (PUBMED:17128255) ].

Family alignment:
View or

There are 15486 Beta-Casp domains in 15481 proteins in SMART's nrdb database.

Click on the following links for more information.