The domain within your query sequence starts at position 246 and ends at position 367; the E-value for the Beta-Casp domain shown below is 7.32e-45.
AQELLLILDEYWQNHPELHDIPIYYASSLAKKCMAVYQTYVNAMNDKIRKQININNPFVF KHISNLKSMDHFDDIGPSVVMASPGMIQNGLSRELFESWCTDKRNGVIIAGYCVEGTLAK HI
Beta-CaspBeta-Casp domain |
---|
SMART accession number: | SM01027 |
---|---|
Description: | The beta-CASP domain is found C terminal to the beta-lactamase domain in pre-mRNA 3'-end-processing endonuclease. The active site of this enzyme is located at the interface of these two domains. |
Interpro abstract (IPR022712): | The beta-CASP domain is found C-terminal to the beta-lactamase domain in pre-mRNA 3'-end-processing endonuclease. The active site of this enzyme is located at the interface of these two domains [(PUBMED:17128255)]. |
Family alignment: |
There are 15486 Beta-Casp domains in 15481 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)