The domain within your query sequence starts at position 102 and ends at position 141; the E-value for the Beta-TrCP_D domain shown below is 3.32e-25.
VKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQ
Beta-TrCP_DD domain of beta-TrCP |
---|
SMART accession number: | SM01028 |
---|---|
Description: | This domain is found in eukaryotes, and is approximately 40 amino acids in length. It is found associated with F-box domain, WD domain. The protein that contains this domain functions as a ubiquitin ligase. Ubiquitination is required to direct proteins towards the proteasome for degradation. This protein is part of the WD40 class of F box proteins. The D domain of these F box proteins is involved in mediating the dimerisation of the protein. Dimerisation is necessary to polyubiquitinate substrates so this D domain is vital in directing substrates towards the proteasome for degradation. |
Interpro abstract (IPR021977): | This entry represents the D domain of beta-TrCP, which is a member of the WD40 class of F box proteins, and functions as a ubiquitin ligase. The D domain of these F box proteins is involved in mediating dimerisation of the protein [ (PUBMED:17574027) ]. Dimerisation is necessary to polyubiquitinate substrates, so this D domain is vital in directing substrates towards the proteasome for degradation. |
GO function: | protein dimerization activity (GO:0046983) |
Family alignment: |
There are 941 Beta-TrCP_D domains in 938 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)