The domain within your query sequence starts at position 377 and ends at position 416; the E-value for the ADSL_C domain shown below is 2e-6.

LPFMATENIIMAMVKAGGSRQVHRFLEEEVRPLLKPYGNE

The domain was found using the schnipsel database

ADSL_C

Adenylosuccinate lyase C-terminus
ADSL_C
SMART accession number:SM00998
Description: Adenylosuccinate lyase catalyses two steps in the synthesis of purine nucleotides: the conversion of succinylaminoimidazole-carboxamide ribotide into aminoimidazole-carboxamide ribotide (the fifth step of de novo IMP biosynthesis); the formation of adenosine monophosphate (AMP) from adenylosuccinate (the final step in the synthesis of AMP from IMP). This entry represents the C-terminal, seven alpha-helical, domain of adenylosuccinate lyase.
Interpro abstract (IPR019468):

Adenylosuccinate lyase catalyses two steps in the synthesis of purine nucleotides: the conversion of succinylaminoimidazole-carboxamide ribotide into aminoimidazole-carboxamide ribotide (the fifth step of de novo IMP biosynthesis); the formation of adenosine monophosphate (AMP) from adenylosuccinate (the final step in the synthesis of AMP from IMP) [ (PUBMED:17485188) ].

This entry represents the seven alpha-helical, C-terminal domain of adenylosuccinate lyase [ (PUBMED:9274883) ]. It is also found in other enzymes, like in 3-carboxy-cis,cis-muconate cycloisomerase.

Family alignment:
View or

There are 18432 ADSL_C domains in 18430 proteins in SMART's nrdb database.

Click on the following links for more information.