The domain within your query sequence starts at position 1790 and ends at position 1883; the E-value for the AKAP_110 domain shown below is 2e-8.
NGKTLLIMNIDMEPGAVDPQLRIILQWLIASEAEVAELYFQDSAKKEFILLSKQLQEKGW KVGDVLQAVLKYYEVVEKPSREERCKSLFDWLLE
The domain was found using the schnipsel database
AKAP_110A-kinase anchor protein 110 kDa |
---|
SMART accession number: | SM00807 |
---|---|
Description: | This family consists of several mammalian protein kinase A anchoring protein 3 (PRKA3) or A-kinase anchor protein 110 kDa (AKAP 110) sequences. Agents that increase intracellular cAMP are potent stimulators of sperm motility. Anchoring inhibitor peptides, designed to disrupt the interaction of the cAMP-dependent protein kinase A (PKA) with A kinase-anchoring proteins (AKAPs), are potent inhibitors of sperm motility. PKA anchoring is a key biochemical mechanism controlling motility. AKAP110 shares compartments with both RI and RII isoforms of PKA and may function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction (PUBMED:10319321). |
Interpro abstract (IPR020799): | This family consists of several mammalian protein kinase A anchoring protein 3 (PRKA3) or A-kinase anchor protein 110kDa (AKAP 110) sequences. Agents that increase intracellular cAMP are potent stimulators of sperm motility. Anchoring inhibitor peptides, designed to disrupt the interaction of the cAMP-dependent protein kinase A (PKA) with A kinase-anchoring proteins (AKAPs), are potent inhibitors of sperm motility. PKA anchoring is a key biochemical mechanism controlling motility. AKAP110 shares compartments with both RI and RII isoforms of PKA and may function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction [ (PUBMED:10319321) ]. |
Family alignment: |
There are 302 AKAP_110 domains in 301 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Literature (relevant references for this domain)
- Links (links to other resources describing this domain)