The domain within your query sequence starts at position 1398 and ends at position 1546; the E-value for the Alpha_kinase domain shown below is 2e-64.

TKFSVSTPSQPSCKSHLESTTKDQEPIFYKAAEGDNIEFGAFVGHRDSMDLQRFKETSNK
IRELLSNDTPENTLKHVGAAGYSECCKTSTSLHSVQAESCSRRASTEDSPEVDSKAALLP
DWLRDRPSNREMPSEGGTLNGLASPFKPV

The domain was found using the schnipsel database

Alpha_kinase

Alpha-kinase family
Alpha_kinase
SMART accession number:SM00811
Description: This family is a novel family of eukaryotic protein kinase catalytic domains, which have no detectable similarity to conventional kinases. The family contains myosin heavy chain kinases and Elongation Factor-2 kinase and a bifunctional ion channel. This family is known as the alpha-kinase family. The structure of the kinase domain revealed unexpected similarity to eukaryotic protein kinases in the catalytic core as well as to metabolic enzymes with ATP-grasp domains.
Interpro abstract (IPR004166):

Proteins containing this domain consist of a novel group of eukaryotic protein kinase catalytic domains, which have no detectable similarity to conventional kinases. Proteins include myosin heavy chain kinases [ (PUBMED:7822274) (PUBMED:9054368) ] and Elongation Factor-2 kinase and a bifunctional ion channel [ (PUBMED:11161216) ].

GO process:protein phosphorylation (GO:0006468)
GO function:protein serine/threonine kinase activity (GO:0004674), ATP binding (GO:0005524)
Family alignment:
View or

There are 3220 Alpha_kinase domains in 3201 proteins in SMART's nrdb database.

Click on the following links for more information.