The domain within your query sequence starts at position 189 and ends at position 229; the E-value for the BCL domain shown below is 2e-19.

DTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSL

The domain was found using the schnipsel database

BCL

BCL (B-Cell lymphoma); contains BH1, BH2 regions
BCL
SMART accession number:SM00337
Description: (BH1, BH2, (BH3 (one helix only)) and not BH4(one helix only)). Involved in apoptosis regulation
Family alignment:
View or

There are 4976 BCL domains in 4959 proteins in SMART's nrdb database.

Click on the following links for more information.