The domain within your query sequence starts at position 681 and ends at position 764; the E-value for the BID_2 domain shown below is 1e-35.

DFVPLPVLQAITPELSGAVVVGDILCLASVLTSLGGVSGTWSSSASHVLYVDPKTGVAIA
RDAGSVTVYYEIAGQLKTFKEIVV

The domain was found using the schnipsel database

BID_2

Bacterial Ig-like domain 2
BID_2
SMART accession number:SM00635
Description: -
Interpro abstract (IPR003343):

Proteins that contain this domain are found in a variety of bacterial and phage surface proteins such as intimins as well as in some uncharacterised eukaryote proteins. Intimin is a bacterial cell-adhesion molecule that mediates the intimate bacterial host-cell interaction. It contains three domains; two immunoglobulin-like domains and a C-type lectin-like module implying that carbohydrate recognition may be important in intimin-mediated cell adhesion [ (PUBMED:10201396) ].

Family alignment:
View or

There are 37760 BID_2 domains in 15247 proteins in SMART's nrdb database.

Click on the following links for more information.