The domain within your query sequence starts at position 97 and ends at position 136; the E-value for the CRM1_C domain shown below is 3e-8.

KIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQ

The domain was found using the schnipsel database

CRM1_C

CRM1 C terminal
CRM1_C
SMART accession number:SM01102
Description: CRM1 (also known as Exportin1) mediates the nuclear export of proteins bearing a leucine-rich nuclear export signal (NES). CRM1 forms a complex with the NES containing protein and the small GTPase Ran. This region forms an alpha helical structure formed by six helical hairpin motifs that are structurally similar to the HEAT repeat, but share little sequence similarity to the HEAT repeat (PUBMED:15574331).
Interpro abstract (IPR014877):

CRM1 (also known as exportin1) mediates the nuclear export of proteins bearing a leucine-rich nuclear export signal (NES). CRM1 forms a complex with the NES containing protein and the small GTPase Ran.

This entry represents the C-terminal domain of CRM1. It forms an alpha helical structure formed by six helical hairpin motifs that are structurally similar to the HEAT repeat, but share little sequence similarity to the HEAT repeat [ (PUBMED:15574331) ].

GO function:nuclear export signal receptor activity (GO:0005049)
Family alignment:
View or

There are 1759 CRM1_C domains in 1757 proteins in SMART's nrdb database.

Click on the following links for more information.