The domain within your query sequence starts at position 246 and ends at position 287; the E-value for the CXC domain shown below is 4e-13.

QVDNGALPSAVNGAAFPSGPALQGPPKITLSGYCDCFSSGDF

The domain was found using the schnipsel database

CXC

Tesmin/TSO1-like CXC domain
CXC
SMART accession number:SM01114
Description: This family includes proteins that have two copies of a cysteine rich motif as follows: C-X-C-X4-C-X3-YC-X-C-X6-C-X3-C-X-C-X2-C. The family includes Tesmin Q9Y4I5 ((PUBMED:10191092)) and TSO1 Q9LE32 ((PUBMED:10769245)) . This family is called a CXC domain in ((PUBMED:10769245)).
Interpro abstract (IPR033467):

This entry represents a CXC domain found in proteins such as Tesmin Q9Y4I5 [ (PUBMED:10191092) ] and TSO1 Q9LE32 [ (PUBMED:10769245) ]. These proteins have two copies of a cysteine rich motif as follows: C-X-C-X4-C-X3-YC-X-C-X6-C-X3-C-X-C-X2-C.

Family alignment:
View or

There are 8766 CXC domains in 6252 proteins in SMART's nrdb database.

Click on the following links for more information.