The domain within your query sequence starts at position 81 and ends at position 178; the E-value for the Cog4 domain shown below is 1e-53.

GPSLQLIEGDAKQLAGMITFTCSLAENVSSKVRQLDLAKNRLYQAIQRADDILDLKFCMD
GVQTALRNEDYEQAAAHIHRYLCLDKSVIELSRQGKEG

The domain was found using the schnipsel database

Cog4

COG4 transport protein
Cog4
SMART accession number:SM00762
Description: This region is found in yeast oligomeric golgi complex component 4 which is involved in ER to Golgi and intra Golgi transport.
Interpro abstract (IPR013167):

This region is found in yeast oligomeric golgi complex component 4 which is involved in ER to Golgi and intra Golgi transport [ (PUBMED:12006647) ].

Family alignment:
View or

There are 1544 Cog4 domains in 1543 proteins in SMART's nrdb database.

Click on the following links for more information.