The domain within your query sequence starts at position 65 and ends at position 97; the E-value for the DUF4206 domain shown below is 4e-15.

DHFSRPVGLFLASDVQQLRQAIEECKQVILELP

The domain was found using the schnipsel database

DUF4206

DUF4206
SMART accession number:SM01175
Description: This is a family of cysteine-rich proteins. Many members also carry a pleckstrin-homology domain,SM00233.
Interpro abstract (IPR025258):

This entry represents a domain found in a group of cysteine-rich proteins. Many members also carry a pleckstrin-homology domain.

Family alignment:
View or

There are 3211 DUF4206 domains in 3211 proteins in SMART's nrdb database.

Click on the following links for more information.