The domain within your query sequence starts at position 7 and ends at position 56; the E-value for the DUF862 domain shown below is 3e-10.

YPVKLYVYDLSKGLARRLSPIMLGGSERQEDLNSRETTGRHLAHLYSCTQ

The domain was found using the schnipsel database

DUF862

PPPDE putative peptidase domain
DUF862
SMART accession number:SM01179
Description: The PPPDE superfamily (after Permuted Papain fold Peptidases of DsRNA viruses and Eukaryotes), consists of predicted thiol peptidases with a circularly permuted papain-like fold. The inference of the likely DUB function of the PPPDE superfamily proteins is based on the fusions of the catalytic domain to Ub-binding PUG (PUB)/UBA domains and a novel alpha-helical Ub-associated domain (the PUL domain, after PLAP, Ufd3p and Lub1p) (PUBMED:15483401).
Interpro abstract (IPR008580):

The PPPDE superfamily (after Permuted Papain fold Peptidases of DsRNA viruses and Eukaryotes), consists of thiol peptidases with a circularly permuted papain-like fold. They contain a PPPDE domain which is a cysteine isopeptidase that exhibits a deSUMOylase activity in PPPDE2 (DeSI-1) and a deubiquinating activity in PPPDE1 (DeSI-2) and is described as a mixed alpha/beta-fold composed of six beta-strands and six alpha-helices. The catalytic dyad is formed by a conserved N-terminal histidine residue on beta2-strand and a conserved C-terminal cysteine residue on the following alpha3-helix (the H-C configuration). This catalytic dyad is invariably conserved in the PPPDE family of proteins [ (PUBMED:15483401) (PUBMED:22498933) (PUBMED:28483520) ].

Family alignment:
View or

There are 4571 DUF862 domains in 4569 proteins in SMART's nrdb database.

Click on the following links for more information.