The domain within your query sequence starts at position 7 and ends at position 75; the E-value for the ENDO3c domain shown below is 7e-46.

SKVADCICLMALDKPQAVPVDVHVWQIAHRDYGWHPKTSQAKGPSPLANKELGNFFRNLW
GPYAGWAQA

The domain was found using the schnipsel database

ENDO3c

endonuclease III
ENDO3c
SMART accession number:SM00478
Description: includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases
Interpro abstract (IPR003265):

The HhH-GPD superfamily gets its name from its hallmark helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate [ (PUBMED:10706276) (PUBMED:8805338) ]. This domain is found in a diverse range of structurally related DNA repair proteins that include: endonuclease III, EC 4.2.99.18 and DNA glycosylase MutY, an A/G-specific adenine glycosylase. Both of these enzymes have a C-terminal iron-sulphur cluster loop (FCL). The methyl-CPG binding protein (MBD4) also contain a related domain that is a thymine DNA glycosylase [ (PUBMED:10499592) ]. The family also includes DNA-3-methyladenine glycosylase II EC 3.2.2.21 8-oxoguanine DNA glycosylases and other members of the AlkA family.

GO process:base-excision repair (GO:0006284)
Family alignment:
View or

There are 64550 ENDO3c domains in 64538 proteins in SMART's nrdb database.

Click on the following links for more information.