The domain within your query sequence starts at position 29 and ends at position 192; the E-value for the EXOIII domain shown below is < 1e-12.

WARNING!
Some of the required catalytic sites were not detected in this domain. It is probably inactive! Check the literature (PubMed 11937058 ) for details.

Catalytic residues
PositionAmino acidPresent?
DomainProtein
N/AN/AENo
145173HNo
ELILLLWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDAENLSSAPQLDQALRQF
NQSVSNELNIGVGTSFCLCTDGQLHIRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCP
GSPDIDKLDVAAMTESLNFEKSDSVSRYGASQVEDMGNIILAMI

The domain was found using the schnipsel database

EXOIII

EXOIII
SMART accession number:SM00479
Description: exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases
Interpro abstract (IPR006055): This entry includes a variety of exonuclease proteins, such as ribonuclease T [(PUBMED:8506149)] and the epsilon subunit of DNA polymerase III. Ribonuclease T is responsible for the end-turnover of tRNA,and removes the terminal AMP residue from uncharged tRNA. DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria, and also exhibits 3' to 5' exonuclease activity.
GO function:exonuclease activity (GO:0004527)
Family alignment:
View or

There are 18618 EXOIII domains in 18613 proteins in SMART's nrdb database.

Click on the following links for more information.