The domain within your query sequence starts at position 492 and ends at position 590; the E-value for the H2B domain shown below is 3e-8.

FERYKMRAQVVLKSKNTKDGSLGKELEAAQEQLAELKDKYISLRLSCEELESQHQQEAED
WKQELARLQQLHRQELERSQLDFRDRTLKLEEELHKQRD

The domain was found using the schnipsel database

H2B

Histone H2B
H2B
SMART accession number:SM00427
Description: -
Interpro abstract (IPR000558):

Histone H2B is one of the five histones, along with H1/H5, H2A, H3 and H4. Two copies of each of the H2A, H2B, H3, and H4 histones ensemble to form the core of the nucleosome [(PUBMED:16472024)]. The nucleosome forms octameric structure that wraps DNA in a left-handed manner. Histones can undergo several different types of post-translational modifications that affect transcription, DNA repair, DNA replication and chromosomal stability.

The HBR (histone H2B repression) domain within the H2B N terminus is important for nucleosome assembly by histone chaperone FACT [(PUBMED:27369377)].

GO component:nucleosome (GO:0000786)
GO function:DNA binding (GO:0003677)
Family alignment:
View or

There are 5436 H2B domains in 5379 proteins in SMART's nrdb database.

Click on the following links for more information.