The domain within your query sequence starts at position 99 and ends at position 323; the E-value for the HSF domain shown below is 2e-88.

ELRQQNEILWREVVTLRQSHSQQHRVIGKLIQCLFGPLQTGPSSTGAKRKLSLMLDEGSA
CSASAKFNACPVSGALLQDPYFIQSPLPETTLGLSPHRARGPIISDIPEDSPSPEGHRLS
PSGGCRRVKGLALLKEEPASPGGDGEAGLALAPNECDFCVTAPPPLPVAVVQAILEGKGS
YSPEGPRSVQQPEPRGPREVPDRGTLGLDRGNRSPESLLPPMLLR

The domain was found using the schnipsel database

HSF

heat shock factor
HSF
SMART accession number:SM00415
Description: -
Interpro abstract (IPR000232):

Heat shock factor (HSF) is a transcriptional activator of heat shock genes [ (PUBMED:2257625) (PUBMED:19864465) ]: it binds specifically to heat shock promoter elements, which are palindromic sequences rich with repetitive purine and pyrimidine motifs [ (PUBMED:2257625) ]. Under normal conditions, HSF is a homo-trimeric cytoplasmic protein, but heat shock activation results in relocalisation to the nucleus [ (PUBMED:1871105) ]. Each HSF monomer contains one C-terminal and three N-terminal leucine zipper repeats [ (PUBMED:1871106) ]. Point mutations in these regions result in disruption of cellular localisation, rendering the protein constitutively nuclear [ (PUBMED:1871105) ]. Two sequences flanking the N-terminal zippers fit the consensus of a bi- partite nuclear localisation signal (NLS). Interaction between the N- and C-terminal zippers may result in a structure that masks the NLS sequences: following activation of HSF, these may then be unmasked, resulting in relocalisation of the protein to the nucleus [ (PUBMED:1871106) ]. The DNA-binding component of HSF lies to the N terminus of the first NLS region, and is referred to as the HSF domain.

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:DNA-binding transcription factor activity (GO:0003700), sequence-specific DNA binding (GO:0043565)
Family alignment:
View or

There are 10788 HSF domains in 10729 proteins in SMART's nrdb database.

Click on the following links for more information.