The domain within your query sequence starts at position 15 and ends at position 50; the E-value for the IL1 domain shown below is 9e-20.

CKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLE

The domain was found using the schnipsel database

IL1

Interleukin-1 homologues
IL1
SMART accession number:SM00125
Description: Cytokines with various biological functions. Interluekin 1 alpha and beta are also known as hematopoietin and catabolin.
Family alignment:
View or

There are 2006 IL1 domains in 2001 proteins in SMART's nrdb database.

Click on the following links for more information.