The domain within your query sequence starts at position 1227 and ends at position 1300; the E-value for the KAT11 domain shown below is 9e-22.

KEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPSGFVCDGCLKKTARTRKENK
LSAKRLPSTRLGTF

The domain was found using the schnipsel database

KAT11

Histone acetylation protein
KAT11
SMART accession number:SM01250
Description: Histone acetylation is required in many cellular processes including transcription, DNA repair, and chromatin assembly. This family contains the fungal KAT11 protein (previously known as RTT109) which is required for H3K56 acetylation. Loss of KAT11 results in the loss of H3K56 acetylation, both on bulk histone and on chromatin (PMID:17046836). KAT11 and H3K56 acetylation appear to correlate with actively transcribed genes and associate with the elongating form of Pol II in yeast (PMID:17046836). This family also incorporates the p300/CBP histone acetyltransferase domain which has different catalytic properties and cofactor regulation to KAT11 (PMID:18568037).
Interpro abstract (IPR013178):

Histone acetylation is required in many cellular processes including transcription, DNA repair, and chromatin assembly. This family contains the fungal RTT109 protein, which is required for H3K56 acetylation [ (PUBMED:17272723) ]. In Schizosaccharomyces pombe (Fission yeast) loss of RTT109 results in the loss of H3K56 acetylation, both on bulk histone and on chromatin [ (PUBMED:17046836) ]. RTT109 and H3K56 acetylation appear to correlate with actively transcribed genes and associate with the elongating form of Pol II in yeast [ (PUBMED:17046836) ]. This family also includes p300/CBP acetyltransferase, which has different catalytic properties and cofactor regulation to RTT109 [ (PUBMED:18568037) ]. CREB-binding protein (CBP) is a transcriptional co-activator that acetylates both histones and non-histone proteins [ (PUBMED:11359896) (PUBMED:15313412) (PUBMED:15313417) ]. CBP binds specifically to phosphorylated CREB and enhances its transcriptional activity toward cAMP-responsive genes [ (PUBMED:11701890) (PUBMED:16287980) ].

GO process:histone acetylation (GO:0016573), regulation of transcription, DNA-templated (GO:0006355)
GO function:histone acetyltransferase activity (GO:0004402)
Family alignment:
View or

There are 3024 KAT11 domains in 3017 proteins in SMART's nrdb database.

Click on the following links for more information.