The domain within your query sequence starts at position 333 and ends at position 362; the E-value for the LRR domain shown below is 5e-10.

ASSLRYLDLSKNPGLLATDEANALYSFLAQ

The domain was found using the schnipsel database

LRR

Leucine-rich repeats, outliers

• SMART accession number: SM00370
• Description: -

There are 1323917 LRR domains in 210080 proteins in SMART's nrdb database.

Cellular role (predicted cellular role)

Cellular role: signalling, translation
Binding / catalysis: Protein-binding

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Radauer C, Lackner P, Breiteneder H
• The Bet v 1 fold: an ancient, versatile scaffold for binding of large,hydrophobic ligands.
• BMC Evol Biol. 2008; 8: 286-286

BACKGROUND: The major birch pollen allergen, Bet v 1, is a member of theubiquitous PR-10 family of plant pathogenesis-related proteins. In recentyears, a number of diverse plant proteins with low sequence similarity toBet v 1 was identified. In addition, determination of the Bet v 1structure revealed the existence of a large superfamily of structurallyrelated proteins. In this study, we aimed to identify and classify all Betv 1-related structures from the Protein Data Bank and all Bet v 1-relatedsequences from the Uniprot database. RESULTS: Structural comparisons ofrepresentative members of already known protein families structurallyrelated to Bet v 1 with all entries of the Protein Data Bank yielded 47structures with non-identical sequences. They were classified into elevenfamilies, five of which were newly identified and not included in theStructural Classification of Proteins database release 1.71. The taxonomicdistribution of these families extracted from the Pfam protein familydatabase showed that members of the polyketide cyclase family and theactivator of Hsp90 ATPase homologue 1 family were distributed among allthree superkingdoms, while members of some bacterial families wereconfined to a small number of species. Comparison of ligand bindingactivities of Bet v 1-like superfamily members revealed that theirfunctions were related to binding and metabolism of large, hydrophobiccompounds such as lipids, hormones, and antibiotics. Phylogeneticrelationships within the Bet v 1 family, defined as the group of proteinswith significant sequence similarity to Bet v 1, were determined byaligning 264 Bet v 1-related sequences. A distance-based phylogenetic treeyielded a classification into 11 subfamilies, nine exclusively containingplant sequences and two subfamilies of bacterial proteins. Plant sequencesincluded the pathogenesis-related proteins 10, the major latexproteins/ripening-related proteins subfamily, and polyketide cyclase-likesequences. CONCLUSION: The ubiquitous distribution of Bet v 1-relatedproteins among all superkingdoms suggests that a Bet v 1-like protein wasalready present in the last universal common ancestor. During evolution,this protein diversified into numerous families with low sequencesimilarity but with a common fold that succeeded as a versatile scaffoldfor binding of bulky ligands.

• Kajava AV
• Structural diversity of leucine-rich repeat proteins.
• J Mol Biol. 1998; 277: 519-27

The superfamily of leucine-rich repeat proteins can be subdivided into at least six subfamilies, characterised by different lengths and consensus sequences of the repeats. It was proposed that the repeats from different subfamilies retain a similar superhelical fold, but differ in the three-dimensional structures of individual repeats. The sequence-structure relationship of three new subfamilies was examined by molecular modelling. I provide structural models for the repeats of all subfamilies. The models enable me to explain residue conservations within each subfamily. Furthermore, the difference in the packing explains why the repeats from different subfamilies never occur simultaneously in the same protein. Finally, these studies suggest different evolutionary origins for the different subfamilies. The approach used for the prediction of the leucine-rich repeat protein structures can be applied to other proteins containing internal repeats of about 20 to 30 residue in length.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
25.44	map04620	Toll-like receptor signaling pathway
10.25	map04080	Neuroactive ligand-receptor interaction
8.13	map04360	Axon guidance
6.71	map04120	Ubiquitin mediated proteolysis
6.36	map04512	ECM-receptor interaction
3.89	map04640	Hematopoietic cell lineage
3.89	map00230	Purine metabolism
3.53	map05222	Small cell lung cancer
3.53	map04110	Cell cycle
3.18	map05120	Epithelial cell signaling in Helicobacter pylori infection
3.18	map04111	Cell cycle - yeast
2.83	map04612	Antigen processing and presentation
2.47	map04510	Focal adhesion
2.47	map04350	TGF-beta signaling pathway
2.12	map00562	Inositol phosphate metabolism
2.12	map00632	Benzoate degradation via CoA ligation
2.12	map04115	p53 signaling pathway
1.77	map00380	Tryptophan metabolism
1.41	map00680	Methane metabolism
1.41	map00940	Phenylpropanoid biosynthesis
1.41	map00360	Phenylalanine metabolism
0.35	map04530	Tight junction
0.35	map04010	MAPK signaling pathway
0.35	map03320	PPAR signaling pathway
0.35	map04810	Regulation of actin cytoskeleton
0.35	map00550	Peptidoglycan biosynthesis

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with LRR domain which could be assigned to a KEGG orthologous group, and not all proteins containing LRR domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of LRR domains in PDB

PDB code	Title
1a4y	RIBONUCLEASE INHIBITOR-ANGIOGENIN COMPLEX
1d0b	INTERNALIN B LEUCINE RICH REPEAT DOMAIN
1dce	CRYSTAL STRUCTURE OF RAB GERANYLGERANYLTRANSFERASE FROM RAT BRAIN
1dfj	RIBONUCLEASE INHIBITOR COMPLEXED WITH RIBONUCLEASE A
1ds9	SOLUTION STRUCTURE OF CHLAMYDOMONAS OUTER ARM DYNEIN LIGHT CHAIN 1
1fqv	Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
1fs2	INSIGHTS INTO SCF UBIQUITIN LIGASES FROM THE STRUCTURE OF THE SKP1-SKP2 COMPLEX
1g9u	CRYSTAL STRUCTURE OF YOPM-LEUCINE RICH EFFECTOR PROTEIN FROM YERSINIA PESTIS
1gwb	structure of glycoprotein 1b
1h6t	Internalin B: crystal structure of fused N-terminal domains.
1h6u	Internalin H: crystal structure of fused N-terminal domains.
1jl5	Novel Molecular Architecture of YopM-a Leucine-rich Effector Protein from Yersinia pestis
1k5d	Crystal structure of Ran-GPPNHP-RanBP1-RanGAP complex
1k5g	Crystal structure of Ran-GDP-AlFx-RanBP1-RanGAP complex
1ltx	Structure of Rab Escort Protein-1 in complex with Rab geranylgeranyl transferase and isoprenoid
1m0z	Crystal Structure of the von Willebrand Factor Binding Domain of Glycoprotein Ib alpha
1m10	Crystal structure of the complex of Glycoprotein Ib alpha and the von Willebrand Factor A1 Domain
1m9l	Relaxation-based Refined Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1
1m9s	Crystal structure of Internalin B (InlB), a Listeria monocytogenes virulence protein containing SH3-like domains.
1o6s	Internalin (Listeria monocytogenes) / E-Cadherin (human) Recognition Complex
1o6t	Internalin (Listeria monocytogenes) - functional domain, uncomplexed
1o6v	Internalin (Listeria monocytogenes) - functional domain, uncomplexed
1ook	Crystal Structure of the Complex of Platelet Receptor GPIb-alpha and Human alpha-Thrombin
1otm	Calcium-binding mutant of the internalin B LRR domain
1otn	Calcium-binding mutant of the Internalin B LRR domain
1oto	Calcium-binding mutant of the internalin B LRR domain
1ozn	1.5A Crystal Structure of the Nogo Receptor Ligand Binding Domain Reveals a Convergent Recognition Scaffold Mediating Inhibition of Myelination
1p8t	Crystal structure of Nogo-66 Receptor
1p8v	CRYSTAL STRUCTURE OF THE COMPLEX OF PLATELET RECEPTOR GPIB-ALPHA AND ALPHA-THROMBIN AT 2.6A
1p9a	Crystal Structure of N-Terminal Domain of Human Platelet Receptor Glycoprotein Ib-alpha at 1.7 Angstrom Resolution
1qyy	Crystal Structure of N-Terminal Domain of Human Platelet Receptor Glycoprotein Ib-alpha at 2.8 Angstrom Resolution
1sq0	Crystal Structure of the Complex of the Wild-type Von Willebrand Factor A1 domain and Glycoprotein Ib alpha at 2.6 Angstrom Resolution
1u0n	The ternary von Willebrand Factor A1-glycoprotein Ibalpha-botrocetin complex
1w8a	Third LRR domain of Drosophila Slit
1xcd	Dimeric bovine tissue-extracted decorin, crystal form 1
1xec	Dimeric bovine tissue-extracted decorin, crystal form 2
1xeu	Crystal Structure of Internalin C from Listeria monocytogenes
1xku	Crystal structure of the dimeric protein core of decorin, the archetypal small leucine-rich repeat proteoglycan
1yrg	THE CRYSTAL STRUCTURE OF RNA1P: A NEW FOLD FOR A GTPASE-ACTIVATING PROTEIN
1z7x	X-ray structure of human ribonuclease inhibitor complexed with ribonuclease I
1ziw	Human Toll-like Receptor 3 extracellular domain structure
2a0z	The molecular structure of toll-like receptor 3 ligand binding domain
2ass	Crystal structure of the Skp1-Skp2-Cks1 complex
2ast	Crystal structure of Skp1-Skp2-Cks1 in complex with a p27 peptide
2bex	Crystal structure of Placental Ribonuclease Inhibitor in complex with Human Eosinophil Derived Neurotoxin at 2A resolution.
2bnh	PORCINE RIBONUCLEASE INHIBITOR
2ca6	MIRAS structure determination from hemihedrally twinned crystals
2ft3	Crystal structure of the biglycan dimer core protein
2id5	Crystal Structure of the Lingo-1 Ectodomain
2o6q	Structural diversity of the hagfish Variable Lymphocyte Receptors A29
2o6r	Structural diversity of the hagfish Variable Lymphocyte Receptors B61
2o6s	Structural diversity of the hagfish Variable Lymphocyte Receptors B59
2omt	Crystal structure of InlA G194S+S/hEC1 complex
2omu	Crystal structure of InlA G194S+S Y369S/hEC1 complex
2omv	Crystal structure of InlA S192N Y369S/hEC1 complex
2omw	Crystal structure of InlA S192N Y369S/mEC1 complex
2omx	Crystal structure of InlA S192N G194S+S/hEC1 complex
2omy	Crystal structure of InlA S192N/hEC1 complex
2omz	Crystal structure of InlA Y369A/hEC1 complex
2p1m	TIR1-ASK1 complex structure
2p1n	Mechanism of Auxin Perception by the TIR1 Ubiqutin Ligase
2p1o	Mechanism of Auxin Perception by the TIR1 ubiquitin ligase
2p1p	Mechanism of Auxin Perception by the TIR1 ubiquitin ligase
2p1q	Mechanism of Auxin Perception by the TIR1 ubiquitin ligase
2q4g	Ensemble refinement of the protein crystal structure of human ribonuclease inhibitor complexed with ribonuclease I
2r9u	Crystal Structure of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain
2uzx	Structure of the human receptor tyrosine kinase Met in complex with the Listeria monocytogenes invasion protein InlB: Crystal form I
2uzy	Structure of the human receptor tyrosine kinase Met in complex with the Listeria monocytogenes invasion protein inlb: low resolution, Crystal form II
2v70	Third LRR domain of human Slit2
2v9s	Second LRR domain of human Slit2
2v9t	Complex between the second LRR domain of Slit2 and The first Ig domain from Robo1
2wfh	The Human Slit 2 Dimerization Domain D4
2wqu	Internalin domain of Listeria monocytogenes InlB: triclinic crystal form
2wqv	Internalin domain of Listeria monocytogenes InlB: rhombohedral crystal form
2wqw	DOUBLE-DISULFIDE CROSS-LINKED CRYSTAL DIMER of the Listeria monocytogenes InlB internalin domain
2wqx	InlB321_4R: S199R, D200R, G206R, A227R, C242A mutant of the Listeria monocytogenes InlB internalin domain
2xot	Crystal structure of neuronal leucine rich repeat protein AMIGO-1
2y5q	Listeria monocytogenes InlB (internalin B) residues 36-392
2z62	Crystal structure of the TV3 hybrid of human TLR4 and hagfish VLRB.61
2z63	Crystal structure of the TV8 hybrid of human TLR4 and hagfish VLRB.61
2z64	Crystal structure of mouse TLR4 and mouse MD-2 complex
2z65	Crystal structure of the human TLR4 TV3 hybrid-MD-2-Eritoran complex
2z66	Crystal structure of the VT3 hybrid of human TLR4 and hagfish VLRB.61
2z7x	Crystal structure of the TLR1-TLR2 heterodimer induced by binding of a tri-acylated lipopeptide
2z80	Crystal structure of the TLR1-TLR2 heterodimer induced by binding of a tri-acylated lipopeptide
2z81	Crystal structure of the TLR1-TLR2 heterodimer induced by binding of a tri-acylated lipopeptide
2z82	Crystal structure of the TLR1-TLR2 heterodimer induced by binding of a tri-acylated lipopeptide
3a79	Crystal structure of TLR2-TLR6-Pam2CSK4 complex
3a7b	Crystal structure of TLR2-Streptococcus Pneumoniae lipoteichoic acid complex
3a7c	Crystal structure of TLR2-PE-DTPA complex
3b2d	Crystal structure of human RP105/MD-1 complex
3c6n	Small molecule agonists and antagonists of F-box protein-substrate interactions in auxin perception and signaling
3c6o	Small molecule agonists and antagonists of F-box protein-substrate interactions in auxin perception and signaling
3c6p	Small molecule agonists and antagonists of F-box protein-substrate interactions in auxin perception and signaling
3cig	Crystal structure of mouse TLR3 ectodomain
3ciy	Mouse Toll-like receptor 3 ectodomain complexed with double-stranded RNA
3cvr	Crystal structure of the full length IpaH3
3e6j	Crystal Structure of Variable Lymphocyte Receptor (VLR) RBC36 in Complex with H-trisaccharide
3fxi	Crystal structure of the human TLR4-human MD-2-E.coli LPS Ra complex
3g06	The Salmonella Virulence Effector SspH2 Functions As A Novel E3 Ligase
3g39	Structure of a lamprey variable lymphocyte receptor
3g3a	Structure of a lamprey variable lymphocyte receptor in complex with a protein antigen
3g3b	Structure of a lamprey variable lymphocyte receptor mutant in complex with a protein antigen
3j0a	Homology model of human Toll-like receptor 5 fitted into an electron microscopy single particle reconstruction
3jbl	3JBL
3kj4	Structure of rat Nogo receptor bound to 1D9 antagonist antibody
3o6n	Crystal Structure of APL1 leucine-rich repeat domain
3ogk	Structure of COI1-ASK1 in complex with coronatine and an incomplete JAZ1 degron
3ogl	Structure of COI1-ASK1 in complex with JA-isoleucine and the JAZ1 degron
3ogm	Structure of COI1-ASK1 in complex with coronatine and the JAZ1 degron
3oja	Crystal structure of LRIM1/APL1C complex
3p72	structure of platelet Glycoprotein 1b alpha with a bound peptide inhibitor
3pmh	Mechanism of Sulfotyrosine-Mediated Glycoprotein Ib Interaction with Two Distinct alpha-Thrombin Sites
3rfj	Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
3rfs	Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
3rg1	Crystal structure of the RP105/MD-1 complex
3rgx	Structural insight into brassinosteroid perception by BRI1
3rgz	Structural insight into brassinosteroid perception by BRI1
3riz	Crystal structure of the plant steroid receptor BRI1 ectodomain
3rj0	Plant steroid receptor BRI1 ectodomain in complex with brassinolide
3t6q	Crystal structure of mouse RP105/MD-1 complex
3tsr	X-ray structure of mouse ribonuclease inhibitor complexed with mouse ribonuclease 1
3twi	Variable Lymphocyte Receptor Recognition of the Immunodominant Glycoprotein of Bacillus anthracis Spores
3ul7	Crystal structure of the TV3 mutant F63W
3ul8	Crystal structure of the TV3 mutant V134L
3ul9	structure of the TV3 mutant M41E
3ula	Crystal structure of the TV3 mutant F63W-MD-2-Eritoran complex
3ulu	Structure of quaternary complex of human TLR3ecd with three Fabs (Form1)
3ulv	Structure of quaternary complex of human TLR3ecd with three Fabs (Form2)
3un9	Crystal structure of an immune receptor
3v44	Crystal structure of the N-terminal fragment of zebrafish TLR5
3v47	Crystal structure of the N-tetminal fragment of zebrafish TLR5 in complex with Salmonella flagellin
3vq1	Crystal structure of mouse TLR4/MD-2/lipid IVa complex
3vq2	Crystal structure of mouse TLR4/MD-2/LPS complex
3w3g	Crystal structure of human TLR8 (unliganded form)
3w3j	Crystal structure of human TLR8 in complex with CL097
3w3k	Crystal structure of human TLR8 in complex with CL075
3w3l	Crystal structure of human TLR8 in complex with Resiquimod (R848) crystal form 1
3w3m	Crystal structure of human TLR8 in complex with Resiquimod (R848) crystal form 2
3w3n	Crystal structure of human TLR8 in complex with Resiquimod (R848) crystal form 3
3wn4	Crystal structure of human TLR8 in complex with DS-877
3wo9	Crystal structure of the lamprey variable lymphocyte receptor C
3wpb	3WPB
3wpc	3WPC
3wpd	3WPD
3wpe	3WPE
3wpf	3WPF
3wpg	3WPG
3wph	3WPH
3wpi	3WPI
3zyi	NetrinG2 in complex with NGL2
3zyj	NetrinG1 in complex with NGL1
3zyn	Crystal structure of the N-terminal leucine rich repeats of Netrin-G Ligand-3
3zyo	Crystal structure of the N-terminal leucine rich repeats and immunoglobulin domain of netrin-G ligand-3
4arn	Crystal structure of the N-terminal domain of Drosophila Toll receptor
4arr	Crystal structure of the N-terminal domain of Drosophila Toll receptor with the magic triangle I3C
4aw4	Engineered variant of Listeria monocytogenes InlB internalin domain with an additional leucine rich repeat inserted
4b8c	nuclease module of the yeast Ccr4-Not complex
4bsr	Structure of the ectodomain of LGR5 in complex with R-spondin-1 ( Fu1Fu2) in P22121 crystal form
4bss	Structure of the ectodomain of LGR5 in complex with R-spondin-1 ( Fu1Fu2) in P21 crystal form
4bst	Structure of the ectodomain of LGR5 in complex with R-spondin-1 ( Fu1Fu2) in P6122 crystal form
4bsu	Structure of the ectodomain of LGR5 in complex with R-spondin-1 ( Fu1Fu2) in C2 crystal form
4bv4	Structure and allostery in Toll-Spatzle recognition
4c2a	Crystal Structure of High-Affinity von Willebrand Factor A1 domain with R1306Q and I1309V Mutations in Complex with High Affinity GPIb alpha
4c2b	Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation in Complex with High Affinity GPIb alpha
4cc4	Complex of InlC of Listeria monocytogenes and human Tuba C-terminal SH3 domain
4cil	YopM-InlB: Hybrid leucine-rich repeat protein
4cnc	Crystal structure of human 5T4 (Wnt-activated inhibitory factor 1, Trophoblast glycoprotein)
4cnm	Crystal structure of human 5T4 (Wnt-activated inhibitory factor 1, Trophoblast glycoprotein)
4fcg	Structure of the leucine-rich repeat domain of the type III effector XCV3220 (XopL)
4fho	Crystal structure of an internalin C2 (inlC2) from Listeria monocytogenes str. 4b F2365 at 1.90 A resolution
4fmz	Crystal structure of an internalin (inlF) from Listeria monocytogenes str. 4b F2365 at 1.91 A resolution
4g8a	Crystal structure of human TLR4 polymorphic variant D299G and T399I in complex with MD-2 and LPS
4hq1	Crystal structure of an LRR protein with two solenoids
4im6	LRR domain from human NLRP1
4j0m	Crystal structure of BRL1 (LRR) in complex with brassinolide
4j4l	Modular evolution and design of the protein binding interface
4k17	Crystal Structure of mouse CARMIL residues 1-668
4k5u	Recognition of the BG-H Antigen by a Lamprey Variable Lymphocyte Receptor
4k79	Recognition of the Thomsen-Friedenreich Antigen by a Lamprey Variable Lymphocyte Receptor
4kng	Crystal structure of human LGR5-RSPO1-RNF43
4kt1	Complex of R-spondin 1 with LGR4 extracellular domain
4kxf	Crystal structure of NLRC4 reveals its autoinhibition mechanism
4li1	Crystal Structures of Lgr4 and its complex with R-spondin1
4li2	Crystal Structures of Lgr4 and its complex with R-spondin1
4lsa	Crystal structure of BRI1 sud1 (Gly643Glu) bound to brassinolide
4lsx	Plant steroid receptor ectodomain bound to brassinolide and SERK1 co-receptor ectodomain
4lxr	Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and innate immunity
4lxs	Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and innate immunity (glycosylated form)
4m7e	Structural insight into BL-induced activation of the BRI1-BAK1 complex
4mn8	Crystal structure of flg22 in complex with the FLS2 and BAK1 ectodomains
4mna	Crystal structure of the free FLS2 ectodomains
4nkg	Crystal structure of SspH1 LRR domain in complex PKN1 HR1b domain
4nkh	Crystal structure of SspH1 LRR domain
4oqt	LINGO-1/Li81 Fab complex
4ow2	4OW2
4p8s	Crystal structure of Nogo-receptor-2
4p91	Crystal structure of the nogo-receptor-2 (27-330)
4peq	4PEQ
4per	4PER
4po4	4PO4
4pq8	Crystal Structure of Engineered Protein, Northeast Structural Genomics Consortium Target OR465
4psj	Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium (NESG) Target OR464.
4puf	4PUF
4q3g	4Q3G
4q3i	4Q3I
4q62	Crystal Structure of Leucine-rich repeat- and Coiled coil-containing Protein from Legionella pneumophila
4qbz	4QBZ
4qc0	4QC0
4qdh	4QDH
4qxe	4QXE
4qxf	4QXF
4r07	4R07
4r08	4R08
4r09	4R09
4r0a	4R0A
4r58	4R58
4r5c	4R5C
4r5d	4R5D
4r6a	4R6A
4r6f	4R6F
4r6g	4R6G
4r6j	4R6J
4rca	4RCA
4rcw	4RCW
4tzh	4TZH
4u06	4U06
4u08	4U08
4u09	4U09
4u7l	4U7L
4ufr	4UFR
4ufs	4UFS
4uip	4UIP
4v2c	4V2C
4v2d	4V2D
4v2e	4V2E
4wp6	4WP6
4xa9	4XA9
4xgo	4XGO
4xm4	4XM4
4xsq	4XSQ
4y61	4Y61
4yeb	4YEB
4z0c	4Z0C
4z5w	4Z5W
4z61	4Z61
4z62	4Z62
4z63	4Z63
4z64	4Z64
5a5c	5A5C
5aj2	5AJ2
5awa	5AWA
5awb	5AWB
5awc	5AWC
5awd	5AWD
5az5	5AZ5
5b0n	5B0N
5b0t	5B0T
5cmn	5CMN
5cmp	5CMP
5d3i	5D3I
5ftt	5FTT
5ftu	5FTU
5gij	5GIJ
5gmf	5GMF
5gmg	5GMG
5gmh	5GMH
5gr9	5GR9
5gs0	5GS0
5gs2	5GS2
5hdh	5HDH
5hyw	5HYW
5hzg	5HZG
5ijb	5IJB
5ijc	5IJC
5ijd	5IJD
5il7	5IL7
5irl	5IRL
5irm	5IRM
5irn	5IRN
5ixo	5IXO
5ixq	5IXQ
5ixt	5IXT
5iyv	5IYV
5iyx	5IYX
5jh5	5JH5