The domain within your query sequence starts at position 2 and ends at position 45; the E-value for the LamG domain shown below is 8e-7.

CSEEEHPMEGPAHLTLNSEVGSLLFSEGGAGRGGAGDVHQPTKG

The domain was found using the schnipsel database

LamG

Laminin G domain
LamG
SMART accession number:SM00282
Description: -
Family alignment:
View or

There are 74121 LamG domains in 31952 proteins in SMART's nrdb database.

Click on the following links for more information.