The domain within your query sequence starts at position 41 and ends at position 132; the E-value for the MIF4G domain shown below is 2e-49.

LTFPFKAESWKPADTEGKKQYDREFLLDIQFMPACIQKPEGLPPISDVVLDKINQPRLSM
RTLDPRILPRGPDFTPAFADFPRQTPGGRGVP

The domain was found using the schnipsel database

MIF4G

Middle domain of eukaryotic initiation factor 4G (eIF4G)
MIF4G
SMART accession number:SM00543
Description: Also occurs in NMD2p and CBP80. The domain is rich in alpha-helices and may contain multiple alpha-helical repeats. In eIF4G, this domain binds eIF4A, eIF3, RNA and DNA. Ponting (TiBS) "Novel eIF4G domain homologues (in press)
Interpro abstract (IPR003890):

MIF4G stands for middle domain of eukaryotic initiation factor 4G (eIF4G). eIF4G is a component of the translation initiation factor eIF4F complex and the cytoplasmic cap-binding protein complex (CBC). In the cytoplasm, cap binding complexes, distinct in their composition from nuclear cap-binding complexes, have important roles in the initiation of mRNA translation.

The MIF4G domain also occurs in other proteins, including CBP80, a component of the nuclear CBC and NMD2, involved in the cytoplasmic nonsense-mediated mRNA decay. The domain is rich in alpha-helices and may contain multiple alpha-helical repeats. In eIF4G, this domain binds to the two other components of the eIF4F complex, eIF4A and eIF3E, and to RNA and DNA [ (PUBMED:10973054) ].

GO function:protein binding (GO:0005515), RNA binding (GO:0003723)
Family alignment:
View or

There are 13738 MIF4G domains in 11270 proteins in SMART's nrdb database.

Click on the following links for more information.