The domain within your query sequence starts at position 2 and ends at position 58; the E-value for the PAM domain shown below is 9e-33.

PEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIIS

The domain was found using the schnipsel database

PAM

PCI/PINT associated module
PAM
SMART accession number:SM00753
Description: -
Family alignment:
View or

There are 0 PAM domains in 0 proteins in SMART's nrdb database.

Click on the following links for more information.

  • Literature (relevant references for this domain)
  • Metabolism (metabolic pathways involving proteins which contain this domain)
  • Structure (3D structures containing this domain)