The domain within your query sequence starts at position 770 and ends at position 815; the E-value for the PBPe domain shown below is 2e-16.
IGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDSKEASAL
The domain was found using the schnipsel database
PBPeEukaryotic homologues of bacterial periplasmic substrate binding proteins. |
---|
SMART accession number: | SM00079 |
---|---|
Description: | Prokaryotic homologues are represented by a separate alignment: PBPb |
Interpro abstract (IPR001320): | There are three classes of ionotropic glutamate receptors (iGluRs), namely NMDA (N-methyl-D-aspartate), AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole-4-propionic acid) and kainate receptors. They are believed to play critical roles in synaptic plasticity. At many synapses in the brain, transient activation of NMDA receptors leads to a persistent modification in the strength of synaptic transmission mediated by AMPA receptors and kainate receptors can act as the induction trigger for long-term changes in synaptic transmission [ (PUBMED:10580501) ]. Ionotropic glutamate receptors (iGluRs) are a highly conserved family of ligand-gated ion channels present in animals, plants, and bacteria, which are best characterised for their roles in synaptic communication in vertebrate nervous systems [ (PUBMED:14977400) ]. A variant subfamily of iGluRs, the Ionotropic Receptors (IRs), consist of non-glutamate-binding chemosensory receptors first identified in Drosophila melanogaster. They function in detecting odors and tastants [ (PUBMED:20808886) ]. |
GO component: | membrane (GO:0016020) |
GO function: | ligand-gated ion channel activity (GO:0015276) |
Family alignment: |
There are 11693 PBPe domains in 11580 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
-
Taxonomic distribution of proteins containing PBPe domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with PBPe domain is also avaliable.
Click on the protein counts, or double click on taxonomic names to display all proteins containing PBPe domain in the selected taxonomic class.
- Metabolism (metabolic pathways involving proteins which contain this domain)
-
% proteins involved KEGG pathway ID Description 52.81 map04080 Neuroactive ligand-receptor interaction 21.91 map04720 Long-term potentiation 12.92 map04020 Calcium signaling pathway 12.36 map04730 Long-term depression This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with PBPe domain which could be assigned to a KEGG orthologous group, and not all proteins containing PBPe domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.
- Structure (3D structures containing this domain)
3D Structures of PBPe domains in PDB
PDB code Main view Title 1ftj CRYSTAL STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J) IN COMPLEX WITH GLUTAMATE AT 1.9 RESOLUTION 1ftk CRYSTAL STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2I) IN COMPLEX WITH KAINATE AT 1.6 A RESOLUTION 1ftl CRYSTAL STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J) IN COMPLEX WITH THE ANTAGONIST DNQX AT 1.8 A RESOLUTION 1ftm CRYSTAL STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J) IN COMPLEX WITH AMPA AT 1.7 RESOLUTION 1fto CRYSTAL STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J) IN THE APO STATE AT 2.0 A RESOLUTION 1fw0 CRYSTAL STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J) IN COMPLEX WITH KAINATE AT 2.0 A RESOLUTION 1gr2 STRUCTURE OF A GLUTAMATE RECEPTOR LIGAND BINDING CORE (GLUR2) COMPLEXED WITH KAINATE 1ii5 CRYSTAL STRUCTURE OF THE GLUR0 LIGAND BINDING CORE COMPLEX WITH L-GLUTAMATE 1iit GLUR0 LIGAND BINDING CORE COMPLEX WITH L-SERINE 1iiw GLUR0 LIGAND BINDING CORE: CLOSED-CLEFT LIGAND-FREE STRUCTURE 1lb8 Crystal structure of the Non-desensitizing GluR2 ligand binding core mutant (S1S2J-L483Y) in complex with AMPA at 2.3 resolution 1lb9 Crystal structure of the Non-desensitizing GluR2 ligand binding core mutant (S1S2J-L483Y) in complex with antagonist DNQX at 2.3 A resolution 1lbb Crystal structure of the GluR2 ligand binding domain mutant (S1S2J-N754D) in complex with kainate at 2.1 A resolution 1lbc Crystal structure of GluR2 ligand binding core (S1S2J-N775S) in complex with cyclothiazide (CTZ) as well as glutamate at 1.8 A resolution 1m5b X-RAY STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J) IN COMPLEX WITH 2-Me-Tet-AMPA AT 1.85 A RESOLUTION. 1m5c X-RAY STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J) IN COMPLEX WITH Br-HIBO AT 1.65 A RESOLUTION 1m5d X-RAY STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J-Y702F) IN COMPLEX WITH Br-HIBO AT 1.73 A RESOLUTION 1m5e X-RAY STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J) IN COMPLEX WITH ACPA AT 1.46 A RESOLUTION 1m5f X-RAY STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J-Y702F) IN COMPLEX WITH ACPA AT 1.95 A RESOLUTION 1mm6 crystal structure of the GluR2 ligand binding core (S1S2J) in complex with quisqualate in a non zinc crystal form at 2.15 angstroms resolution 1mm7 Crystal Structure of the GluR2 Ligand Binding Core (S1S2J) in Complex with Quisqualate in a Zinc Crystal Form at 1.65 Angstroms Resolution 1mqd X-ray structure of the GluR2 ligand-binding core (S1S2J) in complex with (S)-Des-Me-AMPA at 1.46 A resolution. Crystallization in the presence of lithium sulfate. 1mqg Crystal Structure of the GluR2 Ligand Binding Core (S1S2J) in Complex with Iodo-Willardiine at 2.15 Angstroms Resolution 1mqh Crystal Structure of the GluR2 Ligand Binding Core (S1S2J) in Complex with Bromo-Willardiine at 1.8 Angstroms Resolution 1mqi Crystal Structure of the GluR2 Ligand Binding Core (S1S2J) in Complex with Fluoro-Willardiine at 1.35 Angstroms Resolution 1mqj Crystal structure of the GluR2 ligand binding core (S1S2J) in complex with willardiine at 1.65 angstroms resolution 1ms7 X-ray structure of the GluR2 ligand-binding core (S1S2J) in complex with (S)-Des-Me-AMPA at 1.97 A resolution, Crystallization in the presence of zinc acetate 1mxu CRYSTAL STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J) in complex with bromo-willardiine (Control for the crystal titration experiments) 1mxv crystal titration experiments (AMPA co-crystals soaked in 10 mM BrW) 1mxw crystal titration experiments (AMPA co-crystals soaked in 1 mM BrW) 1mxx crystal titration experiments (AMPA co-crystals soaked in 100 uM BrW) 1mxy crystal titration experiments (AMPA co-crystals soaked in 10 uM BrW) 1mxz crystal titration experiments (AMPA co-crystals soaked in 1 uM BrW) 1my0 crystal titration experiments (AMPA co-crystals soaked in 100 nM BrW) 1my1 crystal titration experiments (AMPA co-crystals soaked in 10 nM BrW) 1my2 crystal titration experiment (AMPA complex control) 1my3 crystal structure of glutamate receptor ligand-binding core in complex with bromo-willardiine in the Zn crystal form 1my4 crystal structure of glutamate receptor ligand-binding core in complex with iodo-willardiine in the Zn crystal form 1n0t X-ray structure of the GluR2 ligand-binding core (S1S2J) in complex with the antagonist (S)-ATPO at 2.1 A resolution. 1nnk X-ray structure of the GluR2 ligand-binding core (S1S2J) in complex with (S)-ATPA at 1.85 A resolution. Crystallization with zinc ions. 1nnp X-ray structure of the GluR2 ligand-binding core (S1S2J) in complex with (S)-ATPA at 1.9 A resolution. Crystallization without zinc ions. 1p1n GluR2 Ligand Binding Core (S1S2J) Mutant L650T in Complex with Kainate 1p1o Crystal structure of the GluR2 ligand-binding core (S1S2J) mutant L650T in complex with quisqualate 1p1q Crystal structure of the GluR2 ligand binding core (S1S2J) L650T mutant in complex with AMPA 1p1u Crystal structure of the GluR2 ligand-binding core (S1S2J) L650T mutant in complex with AMPA (ammonium sulfate crystal form) 1p1w Crystal structure of the GluR2 ligand-binding core (S1S2J) with the L483Y and L650T mutations and in complex with AMPA 1pb7 CRYSTAL STRUCTURE OF THE NR1 LIGAND BINDING CORE IN COMPLEX WITH GLYCINE AT 1.35 ANGSTROMS RESOLUTION 1pb8 CRYSTAL STRUCTURE OF THE NR1 LIGAND BINDING CORE IN COMPLEX WITH D-SERINE AT 1.45 ANGSTROMS RESOLUTION 1pb9 CRYSTAL STRUCTURE OF THE NR1 LIGAND BINDING CORE IN COMPLEX WITH D-CYCLOSERINE AT 1.60 ANGSTROMS RESOLUTION 1pbq CRYSTAL STRUCTURE OF THE NR1 LIGAND BINDING CORE IN COMPLEX WITH 5,7-DICHLOROKYNURENIC ACID (DCKA) AT 1.90 ANGSTROMS RESOLUTION 1s50 X-ray structure of the GluR6 ligand binding core (S1S2A) in complex with glutamate at 1.65 A resolution 1s7y Crystal structure of the GluR6 ligand binding core in complex with glutamate at 1.75 A resolution orthorhombic form 1s9t Crystal structure of the GLUR6 ligand binding core in complex with quisqualate at 1.8A resolution 1sd3 Crystal structure of the GLUR6 ligand binding core in complex with 2S,4R-4-methylglutamate at 1.8 Angstrom resolution 1syh X-RAY STRUCTURE OF THE GLUR2 LIGAND-BINDING CORE (S1S2J) IN COMPLEX WITH (S)-CPW399 AT 1.85 A RESOLUTION. 1syi X-RAY STRUCTURE OF THE Y702F MUTANT OF THE GLUR2 LIGAND-BINDING CORE (S1S2J) IN COMPLEX WITH (S)-CPW399 AT 2.1 A RESOLUTION. 1tt1 CRYSTAL STRUCTURE OF THE GLUR6 LIGAND BINDING CORE IN COMPLEX WITH KAINATE 1.93 A RESOLUTION 1txf CRYSTAL STRUCTURE OF THE GLUR5 LIGAND BINDING CORE IN COMPLEX WITH GLUTAMATE AT 2.1 ANGSTROM RESOLUTION 1vso Crystal Structure of the Ligand-Binding Core of iGluR5 in Complex With the Antagonist (S)-ATPO at 1.85 A resolution 1wvj Exploring the GluR2 ligand-binding core in complex with the bicyclic AMPA analogue (S)-4-AHCP 1xhy X-ray structure of the Y702F mutant of the GluR2 ligand-binding core (S1S2J) in complex with kainate at 1.85 A resolution 1y1m Crystal structure of the NR1 ligand binding core in complex with cycloleucine 1y1z Crystal structure of the NR1 ligand binding core in complex with ACBC 1y20 Crystal structure of the NR1 ligand-binding core in complex with ACPC 1yae Structure of the Kainate Receptor Subunit GluR6 Agonist Binding Domain Complexed with Domoic Acid 1ycj Crystal structure of the kainate receptor GluR5 ligand-binding core in complex with (S)-glutamate 2a5s Crystal Structure Of The NR2A Ligand Binding Core In Complex With Glutamate 2a5t Crystal Structure Of The NR1/NR2A ligand-binding cores complex 2aix X-ray structure of the GLUR2 ligand-binding core (S1S2J) in complex with (s)-thio-atpa at 2.2 a resolution. 2al4 CRYSTAL STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J) IN COMPLEX WITH quisqualate and CX614. 2al5 Crystal structure of the GluR2 ligand binding core (S1S2J) in complex with fluoro-willardiine and aniracetam 2anj Crystal Structure of the Glur2 Ligand Binding Core (S1S2J-Y450W) Mutant in Complex With the Partial Agonist Kainic Acid at 2.1 A Resolution 2cmo The structure of a mixed glur2 ligand-binding core dimer in complex with (s)-glutamate and the antagonist (s)-ns1209. 2f34 Crystal Structure of the GluR5 Ligand Binding Core Dimer with UBP310 At 1.74 Angstroms Resolution 2f35 Crystal Structure of the GluR5 Ligand Binding Core with UBP302 At 1.87 Angstroms Resolution 2f36 Crystal Structure of the GluR5 Ligand Binding Core Dimer with Glutamate At 2.1 Angstroms Resolution 2gfe Crystal structure of the GluR2 A476E S673D Ligand Binding Core Mutant at 1.54 Angstroms Resolution 2i0b Crystal structure of the GluR6 ligand binding core ELKQ mutant dimer at 1.96 Angstroms Resolution 2i0c Crystal structure of the GluR6 ligand binding core dimer crosslinked by disulfide bonds between Y490C and L752C at 2.25 Angstroms Resolution 2i3v Measurement of conformational changes accompanying desensitization in an ionotropic glutamate receptor: Structure of G725C mutant 2i3w Measurement of conformational changes accompanying desensitization in an ionotropic glutamate receptor: Structure of S729C mutant 2ojt Structure and mechanism of kainate receptor modulation by anions 2p2a X-ray structure of the GluR2 ligand binding core (S1S2J) in complex with 2-Bn-tet-AMPA at 2.26A resolution 2pbw Crystal Structure of the Ligand-Binding Core of iGluR5 in Complex with the Partial agonist Domoic Acid at 2.5 A Resolution 2pyy Crystal Structure of the GluR0 ligand-binding core from Nostoc punctiforme in complex with (L)-glutamate 2qs1 Crystal structure of the GluR5 ligand binding core dimer in complex with UBP315 at 1.80 Angstroms resolution 2qs2 Crystal structure of the GluR5 ligand binding core dimer in complex with UBP318 at 1.80 Angstroms resolution 2qs3 Crystal structure of the GluR5 ligand binding core dimer in complex with UBP316 at 1.76 Angstroms resolution 2qs4 Crystal structure of the GluR5 ligand binding core dimer in complex with LY466195 at 1.58 Angstroms resolution 2rc7 Crystal structure of the NR3A ligand binding core complex with glycine at 1.58 Angstrom resolution 2rc8 Crystal structure of the NR3A ligand binding core complex with D-serine at 1.45 Angstrom resolution 2rc9 Crystal structure of the NR3A ligand binding core complex with ACPC at 1.96 Angstrom resolution 2rca Crystal structure of the NR3B ligand binding core complex with glycine at 1.58 Angstrom resolution 2rcb Crystal structure of the NR3B ligand binding core complex with D-serine at 1.62 Angstrom resolution 2uxa Crystal structure of the GluR2-flip ligand binding domain, r/g unedited. 2v3t Structure of the ligand-binding core of the ionotropic glutamate receptor-like GluRdelta2 in the apo form 2v3u Structure of the ligand-binding core of the ionotropic glutamate receptor-like GluRdelta2 in complex with D-serine 2wky Crystal structure of the ligand-binding core of GluR5 in complex with the agonist 4-AHCP 2xhd Crystal structure of N-((2S)-5-(6-fluoro-3-pyridinyl)-2,3-dihydro-1H- inden-2-yl)-2-propanesulfonamide in complex with the ligand binding domain of the human GluA2 receptor 2xx7 Crystal structure of 1-(4-(1-pyrrolidinylcarbonyl)phenyl)-3-( trifluoromethyl)-4,5,6,7-tetrahydro-1H-indazole in complex with the ligand binding domain of the Rat GluA2 receptor and glutamate at 2.2A resolution. 2xx8 Crystal structure of N,N-dimethyl-4-(3-(trifluoromethyl)-4,5,6,7- tetrahydro-1H-indazol-1-yl)benzamide in complex with the ligand binding domain of the Rat GluA2 receptor and glutamate at 2.2A resolution. 2xx9 Crystal structure of 1-((2-fluoro-4-(3-(trifluoromethyl)-4,5,6,7- tetrahydro-1H-indazol-1-yl)phenyl)methyl)-2-pyrrolidinone in complex with the ligand binding domain of the Rat GluA2 receptor and glutamate at 2.2A resolution. 2xxh Crystal structure of 1-(4-(2-oxo-2-(1-pyrrolidinyl)ethyl)phenyl)-3-( trifluoromethyl)-4,5,6,7-tetrahydro-1H-indazole in complex with the ligand binding domain of the Rat GluA2 receptor and glutamate at 1.5A resolution. 2xxi Crystal structure of 1-((4-(3-(trifluoromethyl)-6,7-dihydropyrano(4,3- c(pyrazol-1(4H)-yl)phenyl)methyl)-2-pyrrolidinone in complex with the ligand binding domain of the Rat GluA2 receptor and glutamate at 1.6A resolution. 2xxr Crystal structure of the GluK2 (GluR6) wild-type LBD dimer in complex with glutamate 2xxt Crystal structure of the GluK2 (GluR6) wild-type LBD dimer in complex with kainate 2xxu Crystal structure of the GluK2 (GluR6) M770K LBD dimer in complex with glutamate 2xxv Crystal structure of the GluK2 (GluR6) M770K LBD dimer in complex with kainate 2xxw Crystal structure of the GluK2 (GluR6) D776K LBD dimer in complex with glutamate 2xxx Crystal structure of the GluK2 (GluR6) D776K LBD dimer in complex with glutamate (P21 21 21) 2xxy Crystal structure of the GluK2 (GluR6) D776K LBD dimer in complex with kainate 2zns Crystal structure of the ligand-binding core of the human ionotropic glutamate receptor, GluR5, in complex with glutamate 2znt Crystal structure of the ligand-binding core of the human ionotropic glutamate receptor, GluR5, in complex with a novel selective agonist, dysiherbaine 2znu Crystal structure of the ligand-binding core of the human ionotropic glutamate receptor, GluR5, in complex with a novel selective agonist, neodysiherbaine A 3b6q Crystal Structure of the GLUR2 Ligand Binding Core (S1S2J) Mutant T686A in Complex with Glutamate at 2.0 Resolution 3b6t Crystal Structure of the GLUR2 Ligand Binding Core (S1S2J) T686A Mutant in Complex with Quisqualate at 2.1 Resolution 3b6w Crystal Structure of the GLUR2 Ligand Binding Core (S1S2J) T686S Mutant in Complex with Glutamate at 1.7 Resolution 3b7d Crystal structure of the GLUR2 ligand binding core (HS1S2J) in complex with CNQX at 2.5 A resolution 3bbr Crystal structure of the iGluR2 ligand binding core (S1S2J-N775S) in complex with a dimeric positive modulator as well as glutamate at 2.25 A resolution 3bft Structure of the ligand-binding core of GluR2 in complex with the agonist (S)-TDPA at 2.25 A resolution 3bfu Structure of the ligand-binding core of GluR2 in complex with the agonist (R)-TDPA at 1.95 A resolution 3bki Crystal Structure of the GluR2 ligand binding core (S1S2J) in complex with FQX at 1.87 Angstroms 3c31 Crystal structure of GluR5 ligand-binding core in complex with lithium at 1.49 Angstrom resolution 3c32 Crystal structure of GluR5 ligand-binding core in complex with sodium at 1.72 Angstrom resolution 3c33 Crystal structure of GluR5 ligand-binding core in complex with potassium at 1.78 Angstrom resolution 3c34 Crystal structure of GluR5 ligand-binding core in complex with rubidium at 1.82 Angstrom resolution 3c35 Crystal structure of GluR5 ligand-binding core in complex with cesium at 1.97 Angstrom resolution 3c36 Crystal structure of GluR5 ligand-binding core in complex with ammonium ions at 1.68 Angstrom resolution 3dln Crystal structure of the binding domain of the AMPA subunit GluR3 bound to glutamate 3dp4 Crystal structure of the binding domain of the AMPA subunit GluR3 bound to AMPA 3dp6 Crystal structure of the binding domain of the AMPA subunit GluR2 bound to glutamate 3en3 Crystal Structure of the GluR4 Ligand-Binding domain in complex with kainate 3epe Crystal Structure of the GluR4 Ligand-Binding domain in complex with glutamate 3fas X-ray structure of iGluR4 flip ligand-binding core (S1S2) in complex with (S)-glutamate at 1.40A resolution 3fat X-ray structure of iGluR4 flip ligand-binding core (S1S2) in complex with (S)-AMPA at 1.90A resolution 3fuz Crystal structure of the human glutamate receptor, GluR5, ligand-binding core in complex with L-glutamate in space group P1 3fv1 Crystal Structure of the human glutamate receptor, GluR5, ligand-binding core in complex with dysiherbaine in space group P1 3fv2 Crystal structure of the human glutamate receptor, GluR5, ligand-binding core in complex with neodysiherbaine A in space group P1 3fvg Crystal structure of the human glutamate receptor, GluR5, ligand-binding core in complex with MSVIII-19 in space group P1 3fvk Crystal structure of the human glutamate receptor, GluR5, ligand-binding core in complex with 8-deoxy-neodysiherbaine A in space group P1 3fvn Crystal structure of the human glutamate receptor, GluR5, ligand-binding core in complex with 9-deoxy-neodysiherbaine A in space group P1 3fvo Crystal structure of the human glutamate receptor, GluR5, ligand-binding core in complex with 8-epi-neodysiherbaine A in space group P1 3g3f Crystal structure of the GluR6 ligand binding domain dimer with glutamate and NaCl at 1.38 Angstrom resolution 3g3g Crystal structure of the GluR6 ligand binding domain dimer K665R mutant with glutamate and NaCl at 1.3 Angstrom resolution 3g3h Crystal structure of the GluR6 ligand binding domain dimer K665R I749L Q753K mutant with glutamate and NaCl at 1.5 Angstrom resolution 3g3i Crystal structure of the GluR6 ligand binding domain dimer I442H K494E I749L Q753K mutant with glutamate and NaCl at 1.37 Angstrom resolution 3g3j Crystal structure of the GluR6 ligand binding domain dimer I442H K494E K665R I749L Q753K mutant with glutamate and NaCl at 1.32 Angstrom resolution 3g3k Crystal structure of the GluR6 ligand binding domain dimer I442H K494E K665R I749L Q753K E757Q mutant with glutamate and NaCl at 1.24 Angstrom resolution 3gba X-ray structure of iGluR5 ligand-binding core (S1S2) in complex with dysiherbaine at 1.35A resolution 3gbb X-ray strucutre of iGluR5 ligand-binding core (S1S2) in complex with MSVIII-19 at 2.10A resolution 3h03 Crystal structure of the binding domain of the AMPA subunit GluR2 bound to UBP277 3h06 Crystal structure of the binding domain of the AMPA subunit GluR2 bound to the willardiine antagonist, UBP282 3h6t Crystal structure of the iGluR2 ligand-binding core (S1S2J-N754S) in complex with glutamate and cyclothiazide at 2.25 A resolution 3h6u Crystal structure of the iGluR2 ligand-binding core (S1S2J-N754S) in complex with glutamate and NS1493 at 1.85 A resolution 3h6v Crystal structure of the iGluR2 ligand-binding core (S1S2J-N754S) in complex with glutamate and NS5206 at 2.10 A resolution 3h6w Crystal structure of the iGluR2 ligand-binding core (S1S2J-N754S) in complex with glutamate and NS5217 at 1.50 A resolution 3ijo Crystal structure of the AMPA subunit GluR2 bound to the allosteric modulator, althiazide 3ijx Crystal structure of the AMPA subunit GluR2 bound to the allosteric modulator, hydrochlorothiazide 3ik6 Crystal structure of the AMPA subunit GluR2 bound to the allosteric modulator, chlorothiazide 3il1 Crystal structure of the AMPA subunit GluR2 bound to the allosteric modulator, IDRA-21 3ilt Crystal structure of the AMPA subunit GluR2 bound to the allosteric modulator, trichlormethiazide 3ilu Crystal structure of the AMPA subunit GluR2 bound to the allosteric modulator, hydroflumethiazide 3kei Crystal Structure of the GluA4 Ligand-Binding domain L651V mutant in complex with glutamate 3kfm Crystal Structure of the GluA4 Ligand-Binding domain L651V mutant in complex with kainate 3kg2 AMPA subtype ionotropic glutamate receptor in complex with competitive antagonist ZK 200775 3kgc Isolated ligand binding domain dimer of GluA2 ionotropic glutamate receptor in complex with glutamate, LY 404187 and ZK 200775 3lsf Piracetam bound to the ligand binding domain of GluA2 3lsl Piracetam bound to the ligand binding domain of GluA2 (flop form) 3lsw Aniracetam bound to the ligand binding domain of GluA3 3lsx Piracetam bound to the ligand binding domain of GluA3 3m3f PEPA bound to the ligand binding domain of GluA3 (flop form) 3m3k Ligand binding domain (S1S2) of GluA3 (flop) 3m3l PEPA bound to the ligand binding domain of GluA2 (flop form) 3o28 Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator 3o29 Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator 3o2a Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator 3o6g Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator 3o6h Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator 3o6i Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator 3oek Crystal structure of GluN2D ligand-binding core in complex with L-aspartate 3oel Crystal structure of GluN2D ligand-binding core in complex with D-glutamate 3oem Crystal structure of GluN2D ligand-binding core in complex with N-methyl-D-aspartate 3oen Crystal structure of GluN2D ligand-binding core in complex with L-glutamate 3pd8 X-ray structure of the ligand-binding core of GluA2 in complex with (S)-7-HPCA at 2.5 A resolution 3pd9 X-ray structure of the ligand-binding core of GluA2 in complex with (R)-5-HPCA at 2.1 A resolution 3pmv Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator 3pmw Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator 3pmx Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator 3qxm Crystal Structure of Human GluK2 Ligand-Binding Core in Complex with Novel Marine-Derived Toxins, Neodysiherbaine A 3r7x Crystal Structure Analysis of a Quinazolinedione sulfonamide bound to human GluR2: A Novel Class of Competitive AMPA Receptor Antagonists with Oral Activity 3rn8 Crystal Structure of iGluR2 Ligand Binding Domain and Symmetrical Carboxyl Containing Potentiator 3rnn Crystal Structure of iGluR2 Ligand Binding Domain with Symmetric Sulfonamide Containing Potentiator 3rt6 Fluorowillardiine bound to the ligand binding domain of GluA3 3rt8 Chlorowillardiine bound to the ligand binding domain of GluA3 3rtf Chlorowillardiine bound to the ligand binding domain of GluA2 3rtw Nitrowillardiine bound to the ligand binding domain of GluA2 3s2v Crystal Structure of the Ligand Binding Domain of GluK1 in Complex with an Antagonist (S)-1-(2'-Amino-2'-carboxyethyl)-3-[(2-carboxythien-3-yl)methyl]thieno[3,4-d]pyrimidin-2,4-dione at 2.5 A Resolution 3s9e Crystal structure of the kainate receptor GluK3 ligand binding domain in complex with (S)-glutamate 3t93 Glutamate bound to a double cysteine mutant (A452C/S652C) of the ligand binding domain of GluA2 3t96 Iodowillardiine bound to a double cysteine mutant (A452C/S652C) of the ligand binding domain of GluA2 3t9h Kainate bound to a double cysteine mutant (A452C/S652C) of the ligand binding domain of GluA2 3t9u CNQX bound to an oxidized double cysteine mutant (A452C/S652C) of the ligand binding domain of GluA2 3t9v CNQX bound to a reduced double cysteine mutant (A452C/S652C) of the ligand binding domain of GluA2 3t9x Glutamate bound to a double cysteine mutant (V484C/E657C) of the ligand binding domain of GluA2 3tdj Crystal structure of the GluA2 ligand-binding domain (S1S2J-L483Y-N754S) in complex with glutamate and BPAM-97 at 1.95 A resolution 3tkd Crystal structure of the GluA2 ligand-binding domain (S1S2J-L483Y-N754S) in complex with glutamate and cyclothiazide at 1.45 A resolution 3tza Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with the antagonist (S)-2-amino-3-(2-(2-carboxyethyl)-5-chloro-4-nitrophenyl)propionic acid at 1.9A resolution 3u92 Crystal structure of the GluK3 ligand binding domain complex with kainate and zinc: P2221 form 3u93 Crystal structure of the GluK3 ligand binding domain complex with glutamate and zinc: P2221 form 3u94 Crystal structure of the GluK3 ligand binding domain complex with glutamate and zinc: P21212 form 3ua8 Crystal Structure Analysis of a 6-Amino Quinazolinedione Sulfonamide bound to human GluR2 4bdl Crystal structure of the GluK2 K531A LBD dimer in complex with glutamate 4bdm Crystal structure of the GluK2 K531A LBD dimer in complex with kainate 4bdn Crystal structure of the GluK2 K531A-T779G LBD dimer in complex with glutamate 4bdo Crystal structure of the GluK2 K531A-T779G LBD dimer in complex with kainate 4bdq Crystal structure of the GluK2 R775A LBD dimer in complex with glutamate 4bdr Crystal structure of the GluK2 R775A LBD dimer in complex with kainate 4dld Crystal structure of the GluK1 ligand-binding domain (S1S2) in complex with the antagonist (S)-2-amino-3-(2-(2-carboxyethyl)-5-chloro-4-nitrophenyl)propionic acid at 2.0 A resolution 4e0w Crystal structure of the kainate receptor GluK3 ligand binding domain in complex with kainate 4e0x Crystal structure of the kainate receptor GluK1 ligand-binding domain in complex with kainate in the absence of glycerol 4f1y CNQX bound to the ligand binding domain of GluA3 4f22 Kainate bound to the K660A mutant of the ligand binding domain of GluA3 4f29 Quisqualate bound to the ligand binding domain of GluA3i 4f2o Quisqualate bound to the D655A mutant of the ligand binding domain of GluA3 4f2q Quisqualate bound to the D655A mutant of the ligand binding domain of GluA3 4f31 Kainate bound to the D655A mutant of the ligand binding domain of GluA3 4f39 Kainate bound to the ligand binding domain of GluA3 4f3b Glutamate bound to the D655A mutant of the ligand binding domain of GluA3 4f3g Kainate bound to the ligand binding domain of GluA3i 4fat Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator 4g8m Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with the agonist CBG-IV at 2.05A resolution 4g8n Crystal structure of the kainate receptor GluK3 ligand-binding domain in complex with the agonist G8M 4gxs Ligand binding domain of GluA2 (AMPA/glutamate receptor) bound to (-)-kaitocephalin 4h8i Structure of GluK2-LBD in complex with GluAzo 4h8j Structure of GluA2-LBD in complex with MES 4igr Crystal structure of the kainate receptor GluK3 ligand-binding domain in complex with the agonist ZA302 4igt Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with the agonist ZA302 at 1.24A resolution 4isu Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with the antagonist (2R)-IKM-159 at 2.3A resolution. 4iy5 Crystal structure of the glua2 ligand-binding domain (S1S2J-L483Y-N754S) in complex with glutamate and CX516 at 2.0 A resolution 4iy6 Crystal structure of the GLUA2 ligand-binding domain (S1S2J-L483Y-N754S) in complex with glutamate and ME-CX516 at 1.72 A resolution 4jwx GluN2A ligand-binding core in complex with propyl-NHP5G 4jwy GluN2D ligand-binding core in complex with propyl-NHP5G 4kcc Crystal Structure of the NMDA Receptor GluN1 Ligand Binding Domain Apo State 4kcd Crystal Structure of the NMDA Receptor GluN3A Ligand Binding Domain Apo State 4kfq Crystal structure of the NMDA receptor GluN1 ligand binding domain in complex with 1-thioxo-1,2-dihydro-[1,2,4]triazolo[4,3-a]quinoxalin-4(5H)-one 4l17 GluA2-L483Y-A665C ligand-binding domain in complex with the antagonist DNQX 4lz5 Crystal structures of GLuR2 ligand-binding-domain in complex with glutamate and positive allosteric modulators 4lz7 Crystal structures of GLuR2 ligand-binding-domain in complex with glutamate and positive allosteric modulators 4lz8 Crystal structures of GLuR2 ligand-binding-domain in complex with glutamate and positive allosteric modulators 4mf3 Crystal Structure of Human GRIK1 complexed with a 6-(tetrazolyl)aryl decahydroisoquinoline antagonist 4mh5 Crystal structure of the kainate receptor GluK3 ligand binding domain in complex with (S)-glutamate 4n07 Crystal structure of the GluA2 ligand-binding domain (S1S2J-L483Y-N754S) in complex with glutamate and BPAM-344 at 1.87 A resolution 4nf4 Crystal structure of GluN1/GluN2A ligand-binding domain in complex with DCKA and glutamate 4nf5 Crystal structure of GluN1/GluN2A ligand-binding domain in complex with glycine and D-AP5 4nf6 Crystal structure of GluN1/GluN2A ligand-binding domain in complex with glycine and PPDA 4nf8 Crystal structure of GluN1/GluN2A ligand-binding domain in complex with glycine and glutamate in PEG2000MME 4nwc 4NWC 4nwd 4NWD 4o3a Crystal structure of the glua2 ligand-binding domain in complex with L-apartate at 1.80 a resolution 4o3b Crystal structure of an open/closed glua2 ligand-binding domain dimer at 1.91 A resolution 4o3c Crystal structure of the GLUA2 ligand-binding domain in complex with L-apartate at 1.50 A resolution 4pe5 4PE5 4q30 4Q30 4qf9 4QF9 4tll 4TLL 4tlm 4TLM 4u1o 4U1O 4u1w 4U1W 4u1x 4U1X 4u1y 4U1Y 4u1z 4U1Z 4u21 4U21 4u22 4U22 4u23 4U23 4u2p 4U2P 4u2q 4U2Q 4u2r 4U2R 4u4f 4U4F 4u4g 4U4G 4u4s 4U4S 4u4x 4U4X 4u5b 4U5B 4u5c 4U5C 4u5d 4U5D 4u5e 4U5E 4u5f 4U5F 4uq6 4UQ6 4uqj 4UQJ 4uqk 4UQK 4uqq 4UQQ 4wxj 4WXJ 4x48 4X48 4yki 4YKI 4ykj 4YKJ 4ykk 4YKK 4ykp 4YKP 4yma 4YMA 4ymb 4YMB 4yu0 4YU0 4z0i 4Z0I 4zv1 4ZV1 4zv2 4ZV2 5buu 5BUU 5cbr 5CBR 5cbs 5CBS 5cc2 5CC2 5cmb 5CMB 5cmc 5CMC 5cmk 5CMK 5cmm 5CMM 5ddn 5DDN 5ddx 5DDX 5de4 5DE4 5dex 5DEX 5dt6 5DT6 5dtb 5DTB 5ehm 5EHM 5ehs 5EHS 5elv 5ELV 5fhm 5FHM 5fhn 5FHN 5fho 5FHO 5fth 5FTH 5fti 5FTI 5fxg 5FXG 5fxh 5FXH 5fxi 5FXI 5fxj 5FXJ 5fxk 5FXK 5h8f 5H8F 5h8h 5H8H 5h8n 5H8N 5h8q 5H8Q 5h8s 5H8S 5i2k 5I2K 5i2n 5I2N 5i56 5I56 5i57 5I57 5i58 5I58 5i59 5I59 5ide 5IDE 5idf 5IDF 5ikb 5IKB 5iou 5IOU 5iov 5IOV 5ipq 5IPQ 5ipr 5IPR 5ips 5IPS 5ipt 5IPT 5ipu 5IPU 5ipv 5IPV 5jty 5JTY 5kbs 5KBS 5kbt 5KBT 5kbu 5KBU 5kbv 5KBV 5kcj 5KCJ 5kdt 5KDT 5kk2 5KK2 5kuf 5KUF 5kuh 5KUH 5l1b 5L1B 5l1e 5L1E 5l1f 5L1F 5l1g 5L1G 5l1h 5L1H 5tp9 5TP9 5tpa 5TPA - Links (links to other resources describing this domain)
-
INTERPRO IPR001320