The domain within your query sequence starts at position 706 and ends at position 748; the E-value for the PLAc domain shown below is 3e-10.
WARNING!
Some of the required catalytic sites were not detected in this domain. It is probably inactive! Check the literature (PubMed 10319815 ) for details.
Catalytic residues | |||
---|---|---|---|
Position | Amino acid | Present? | |
Domain | Protein | ||
N/A | N/A | S | No |
VIKDAIVESIEYRRQNPSRCSVSLSNVEARKFFNKEFLSKPTV
The domain was found using the schnipsel database
PLAcCytoplasmic phospholipase A2, catalytic subunit |
---|
SMART accession number: | SM00022 |
---|---|
Description: | Cytosolic phospholipases A2 hydrolyse arachidonyl phospholipids. Family includes phospholipases B isoforms. |
Interpro abstract (IPR002642): | This family consists of lysophospholipase / phospholipase B EC 3.1.1.5 and cytosolic phospholipase A2 which also has a C2 domain IPR000008 . Phospholipase B enzymes catalyse the release of fatty acids from lysophsopholipids and are capable in vitro of hydrolyzing all phospholipids extractable from yeast cells [ (PUBMED:8027085) ]. Cytosolic phospholipase A2 associates with natural membranes in response to physiological increases in Ca 2+ and selectively hydrolyses arachidonyl phospholipids [ (PUBMED:8051052) ], the aligned region corresponds the carboxy-terminal Ca 2+ -independent catalytic domain of the protein as discussed in [ (PUBMED:8051052) ]. |
GO process: | phospholipid catabolic process (GO:0009395) |
GO function: | phospholipase activity (GO:0004620) |
Family alignment: |
There are 4116 PLAc domains in 4116 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Literature (relevant references for this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)